Recombinant Pectobacterium carotovorum subsp. carotovorum Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pectobacterium carotovorum subsp. carotovorum Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA)

Pectobacterium carotovorum subsp. carotovorum Monofunctional Biosynthetic Peptidoglycan Transglycosylase (MtgA), also referred to as monofunctional TGase, is an enzyme involved in peptidoglycan biosynthesis within bacteria . Specifically, MtgA is a glycosyltransferase that plays a role in the elongation of glycan strands, which are a key component of peptidoglycans that constitute bacterial cell walls . MtgA uses lipid-linked disaccharide-pentapeptide as a substrate to lengthen glycan strands .

Peptidoglycan is a macromolecule composed of aminosugar strands cross-linked by short peptides and is a key component of bacterial cell walls . These strands are typically made of repeating N-acetylglucosamine (GlcNAc) and N-acetylmuramic acid (MurNAc) disaccharides .

Function and Role in Peptidoglycan Synthesis

MtgA is a monofunctional enzyme that possesses glycosyltransferase activity . Glycosyltransferases like MtgA are crucial in the terminal stages of peptidoglycan formation. They are responsible for polymerizing disaccharide subunits by transglycosylation, which occurs on the outer side of the bacterial membrane .

Activity and Interactions

  • MtgA exhibits in vitro glycosyltransferase activity and can catalyze glycan chain polymerization .

  • Optimal in vitro transglycosylase activity can be achieved in the presence of MnCl2 .

  • MtgA may interact with transpeptidase enzymes, suggesting that key cell wall-synthetic enzymes function together to coordinate and catalyze peptidoglycan synthesis .

Biochemical Traits of P. carotovorum

TestsPccPcbPco
Genomes tested (n)182529
Acid produced from
α-Methyl glucoside0029
d-Arabitol0029
Sorbitol0029
Palatinose0029
Inulin0029

Pcc = P. carotovorum

Pcb = P. carotovorum

Pco = P. carotovorum

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mtgA; PC1_0303; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
mtgA
Target Protein Sequence
MKWSRGRGGLLAWLKRLIVRSVLVVIGAWLAGILLFSFLPVPFSAVMVDRQISAWLKGEF SYVAHSDWVSMEEIAPEMALAVMAAEDQKFPDHWGFDLDAIGQALKHNERNTQRIRGAST LSQQMVKNLFLWDGRSWVRKGLEAGITTGVELVWTKRRILTVYLNIAEFGPGIFGVEAAA RRYFNKPASRLTASESALLAAVLPNPIRFRANAPSSYVIQRQQWILRQMRQMGGDAFLRA NNLN
Uniprot No.

Target Background

Function

Function: A peptidoglycan polymerase catalyzing glycan chain elongation from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the primary function of mtgA in Pectobacterium carotovorum?

The monofunctional peptidoglycan glycosyltransferase (mtgA) in P. carotovorum, similar to its homolog in E. coli, catalyzes glycan chain elongation during bacterial cell wall biosynthesis. This enzyme plays a critical role in peptidoglycan assembly, which is essential for maintaining cell wall integrity. In E. coli, mtgA has been shown to localize at the division site of cells deficient in PBP1b with thermosensitive PBP1a, suggesting it may have a compensatory role in peptidoglycan synthesis when primary biosynthetic machinery is compromised .

Research indicates that mtgA interacts with three constituents of the divisome: PBP3, FtsW, and FtsN, suggesting collaborative action within the divisome to form peptidoglycan of new poles during cell division . This interaction network positions mtgA as a potential coordinator in cell wall biosynthesis, particularly during bacterial cell division.

How does mtgA differ from bifunctional penicillin-binding proteins (PBPs)?

Unlike bifunctional penicillin-binding proteins that possess both transglycosylase and transpeptidase activities, mtgA is a monofunctional enzyme specifically catalyzing glycosyltransferase reactions. This specialization allows mtgA to focus exclusively on glycan chain polymerization using lipid II as a substrate without participating in peptide cross-linking.

In experimental settings, when GFP-mtgA is overexpressed, a 2.4-fold increase in peptidoglycan polymerization occurs compared to control conditions (26% versus 11% of lipid II used), demonstrating its glycosyltransferase activity in vitro . This activity is confirmed through assays using radiolabeled GlcNAc-lipid II substrate, with reaction products being sensitive to lysozyme digestion, verifying their peptidoglycan nature.

What experimental approaches are suitable for studying mtgA localization in bacterial cells?

To study mtgA localization, fluorescent protein fusion and microscopy represent the primary methodological approach. The protocol involves:

  • Construction of a GFP-mtgA fusion protein by cloning the mtgA gene into a vector containing GFP

  • Transformation of the construct into the bacterial strain of interest

  • Induction of protein expression under appropriate conditions

  • Visualization using fluorescence microscopy to track protein localization

This approach has successfully demonstrated that in E. coli, mtgA localizes at the division site in cells deficient in PBP1b and expressing thermosensitive PBP1a . When analyzing localization data, it's important to examine multiple cells across different growth phases and to include control strains expressing unfused GFP to distinguish between specific localization and background fluorescence.

How can one establish an effective experimental design to study mtgA function in Pectobacterium carotovorum?

An effective experimental design to study mtgA function requires a systematic approach that includes multiple controls and variables. The following table outlines a comprehensive experimental design framework:

ComponentDescription
HypothesisMtgA in P. carotovorum functions as a compensatory glycosyltransferase during cell division when primary PBPs are inhibited or deficient
Independent VariableExpression levels of mtgA (normal expression, overexpression, gene knockout)
Dependent VariablePeptidoglycan synthesis rate measured by incorporation of radiolabeled lipid II precursors
Control Groups1. Wild-type P. carotovorum
2. PBP1b-deficient strain
3. Strain with inactivated mtgA
Controlled Variables1. Growth conditions (temperature, media composition)
2. Cell density during harvesting
3. Incubation time with substrates
Number of TrialsMinimum 3 biological replicates with 3 technical replicates each

For execution, prepare bacterial cultures of each strain type, extract membrane fractions, and conduct in vitro peptidoglycan synthesis assays using radiolabeled GlcNAc-lipid II as described in previous protocols . Data collection should include quantification of polymerized peptidoglycan, with measurements taken at multiple time points to establish reaction kinetics. All measurements must use metric units, and statistical analysis should include ANOVA with post-hoc tests to determine significance between experimental groups .

What are the optimal conditions for expressing and purifying recombinant mtgA from Pectobacterium carotovorum?

The optimization of expression and purification conditions for recombinant mtgA requires careful consideration of multiple factors:

Expression System Selection:

  • E. coli BL21(DE3) strain is recommended for high-level expression

  • pET vector systems containing T7 promoter provide controllable induction

Expression Conditions:

  • Induction at OD600 = 0.6-0.8 with 0.5 mM IPTG

  • Post-induction cultivation at 18-20°C for 16-18 hours minimizes inclusion body formation

  • Supplementation with 0.1% glucose reduces basal expression

Purification Protocol:

  • Cell lysis in buffer containing 50 mM HEPES pH 7.0, 300 mM NaCl, 10% glycerol

  • Membrane fraction isolation via ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization of membrane proteins using 1% detergent (CHAPS or n-dodecyl-β-D-maltoside)

  • Affinity chromatography using nickel-NTA resin for His-tagged protein

  • Size exclusion chromatography as a polishing step

Activity Verification:
Verify the activity of purified mtgA using in vitro assays with lipid II substrate as described previously. A functional enzyme should demonstrate a 2-3 fold increase in peptidoglycan polymerization compared to negative controls .

How can bacterial two-hybrid systems be employed to investigate mtgA protein interactions in Pectobacterium carotovorum?

Bacterial two-hybrid (BTH) systems offer a powerful approach to investigate protein-protein interactions in a bacterial context. For studying mtgA interactions:

  • System Selection: The adenylate cyclase-based bacterial two-hybrid system is preferable, where interaction between proteins fused to T18 and T25 fragments of adenylate cyclase reconstitutes enzymatic activity.

  • Construction of Fusion Proteins:

    • Create N-terminal and C-terminal fusions of mtgA with T18 and T25 fragments

    • Design fusion constructs with flexible linkers such as (G₄S)₃ to minimize steric hindrance

    • Include transmembrane domains when studying membrane protein interactions

  • Controls and Validation:

    • Positive control: Known interacting pair (e.g., leucine zipper domains)

    • Negative control: Empty vectors or non-interacting proteins

    • Self-interaction control: T18-mtgA with T25-mtgA (as mtgA has been shown to interact with itself in E. coli)

  • Quantification Methods:

    • β-galactosidase activity assays using ONPG substrate

    • Growth on selective media containing X-gal for visual confirmation

    • Fluorometry for GFP reporter systems

In E. coli, this approach has successfully demonstrated that mtgA interacts with PBP3, FtsW, and FtsN, with interaction strength comparable to established protein pairs like PBP1b-PBP3 . When adapting this methodology to P. carotovorum, researchers should consider species-specific optimizations of codon usage and expression temperatures.

What is the relationship between mtgA and pathogenicity-related genes in Pectobacterium carotovorum?

The relationship between mtgA and pathogenicity in P. carotovorum involves complex regulatory networks that connect cell wall biosynthesis with virulence mechanisms. While direct evidence linking mtgA to hrp (hypersensitive response and pathogenicity) genes is limited, several connections can be inferred:

  • Cell Wall Integrity and Pathogenicity:
    Peptidoglycan synthesis enzymes like mtgA maintain cell wall integrity, which is essential for bacterial survival during host colonization. Disruptions in peptidoglycan assembly may alter bacterial responses to environmental stresses encountered during infection.

  • Potential Regulatory Overlaps:
    In P. carotovorum, the hrp gene cluster is regulated by HrpL, a sigma factor that controls various pathogenicity genes . Although mtgA is not directly regulated by HrpL, both systems respond to environmental conditions encountered during host interaction.

  • Comparative Expression Analysis:
    Studies in P. carotovorum have shown that high expression levels of hrpL and hrpN genes negatively impact disease symptoms on Arabidopsis plants , suggesting a balanced expression of virulence factors is crucial for successful pathogenesis. Similar balance may be required for cell wall biosynthesis enzymes like mtgA.

Researchers investigating these relationships should consider designing experiments that simultaneously monitor expression of both mtgA and hrp genes under various infection-relevant conditions to identify potential regulatory connections.

How does the mutation of mtgA affect virulence in plant infection models?

Assessment of mtgA mutation effects on virulence requires systematic infection assays using appropriate plant models. Based on established methodologies for virulence testing:

Experimental Design:

  • Generate precise mtgA knockout mutants using allelic exchange or CRISPR-Cas methods

  • Create complemented strains expressing wild-type mtgA to verify phenotype restoration

  • Select appropriate plant hosts (potato, tobacco, Arabidopsis) based on infection model requirements

Infection Protocol:

  • Grow bacterial strains (wild-type, mtgA mutant, complemented strain) for 24 hours in LB broth

  • Harvest by centrifugation and wash in sterile water

  • Resuspend to standardized optical density (OD600 = 1.0, approximately 1×10⁸ CFU/ml)

  • Inoculate plant tissue (leaves or tuber slices) with 20 μl bacterial suspension

  • Incubate under controlled conditions (e.g., 30°C for potato tissue, room temperature for intact plants)

  • Assess symptom development at 24, 48, and 72 hours post-inoculation

Quantitative Assessments:

  • Measure lesion diameter or macerated tissue area

  • Determine bacterial population in infected tissue by dilution plating

  • Quantify plant defense responses (e.g., reactive oxygen species, defense gene expression)

What methods are most effective for analyzing the structural features of mtgA that contribute to its glycosyltransferase activity?

Structural analysis of mtgA requires a multi-faceted approach combining computational prediction, experimental structure determination, and functional validation:

Computational Approaches:

  • Homology modeling based on related glycosyltransferases with known structures

  • Molecular dynamics simulations to analyze substrate binding and catalytic mechanism

  • Conservation analysis across bacterial species to identify functionally critical residues

Experimental Structure Determination:

  • X-ray crystallography of purified mtgA (challenges include obtaining diffraction-quality crystals of membrane-associated proteins)

  • Cryo-electron microscopy for visualization of larger complexes

  • NMR spectroscopy for dynamic analysis of specific domains

Structure-Function Analysis:

  • Site-directed mutagenesis of predicted catalytic residues

  • Activity assays of mutant proteins using lipid II substrates

  • In vivo complementation studies with mutant variants

For functional validation, researchers can employ the in vitro glycosyltransferase assay using radiolabeled lipid II substrate and analyze reaction products by paper chromatography or HPLC. The enzyme activity can be quantified by measuring the incorporation of radiolabeled precursors into polymeric peptidoglycan, with typical active enzymes showing 20-30% conversion rates under optimal conditions .

How can genetic engineering be used to modify mtgA function for enhanced peptidoglycan synthesis?

Genetic engineering of mtgA for enhanced function requires strategic modifications based on structure-function relationships:

Targeted Engineering Approaches:

  • Catalytic Domain Enhancement:

    • Identify rate-limiting steps in catalysis through kinetic analysis

    • Introduce mutations at key residues based on comparison with highly active homologs

    • Create chimeric proteins incorporating domains from more efficient glycosyltransferases

  • Substrate Specificity Modification:

    • Alter binding pocket residues to accommodate modified lipid II substrates

    • Engineer broader substrate tolerance for biotechnological applications

  • Regulation Optimization:

    • Modify promoter elements to increase expression under specific conditions

    • Replace native promoter with constitutive or inducible systems for controlled expression

Validation Framework:

  • In vitro activity assays comparing wild-type and engineered variants

  • Complementation studies in mtgA-deficient strains

  • Growth rate and morphology analysis under various stress conditions

Expression Optimization:
When overexpressing engineered mtgA variants, researchers should consider the potential toxicity of excess glycosyltransferase activity. In previous studies, a 2.4-fold increase in peptidoglycan polymerization was observed with GFP-MtgA overexpression , but excessive activity might disrupt cell wall homeostasis. Optimal expression levels should be determined empirically for each engineered variant.

What are the most reliable methods for quantifying mtgA expression levels in Pectobacterium carotovorum during various growth phases?

Accurate quantification of mtgA expression requires complementary approaches targeting both transcript and protein levels:

Transcript Quantification:

  • RT-qPCR Protocol:

    • Extract total RNA using RNA isolation kits optimized for bacterial samples

    • Synthesize cDNA using reverse transcriptase and random primers

    • Perform qPCR using mtgA-specific primers and reference gene controls

    • Calculate relative expression using the 2^(-ΔΔCt) method

  • RNA-Seq Analysis:

    • Provides genome-wide expression context

    • Allows identification of co-regulated genes

    • Requires bioinformatic pipeline for mapping and quantification

Protein Quantification:

  • Western Blot Analysis:

    • Generate specific antibodies against P. carotovorum mtgA

    • Extract total protein from bacterial cultures at different growth phases

    • Perform SDS-PAGE and immunoblotting with anti-mtgA antibodies

    • Quantify band intensity relative to loading controls (e.g., RpoD)

  • Targeted Proteomics (MRM/PRM):

    • Identify unique peptides from mtgA for mass spectrometry detection

    • Synthesize isotopically labeled standard peptides for absolute quantification

    • Extract and digest proteins from bacterial samples

    • Quantify mtgA using liquid chromatography-mass spectrometry

Fluorescent Reporter Systems:
For dynamic monitoring of mtgA expression, construct transcriptional fusions of the mtgA promoter with fluorescent reporters such as GFP. This approach has been successfully used to identify promoters with high expression levels using fluorometer measurements .

How can one design experiments to investigate the role of mtgA in antibiotic resistance mechanisms?

Investigating mtgA's role in antibiotic resistance requires a structured experimental approach:

Experimental Design Framework:

ComponentDescription
HypothesisMtgA overexpression or mutation alters susceptibility to cell wall-targeting antibiotics
Independent Variables1. MtgA expression level (wild-type, overexpression, knockout)
2. Antibiotic type and concentration
3. Growth conditions (temperature, osmolarity)
Dependent Variables1. Minimum inhibitory concentration (MIC)
2. Growth kinetics under antibiotic stress
3. Cell morphology changes
4. Peptidoglycan composition alterations
Control Groups1. Wild-type P. carotovorum
2. Strains with altered expression of other peptidoglycan synthesis genes
Analytical Methods1. Broth microdilution for MIC determination
2. Time-kill assays
3. Microscopy for morphology assessment
4. HPLC analysis of peptidoglycan composition

Advanced Analytical Approaches:

  • Peptidoglycan Structure Analysis:

    • Isolate peptidoglycan from bacterial cultures

    • Digest with muramidases to release muropeptides

    • Analyze composition by HPLC and mass spectrometry

    • Compare muropeptide profiles between wild-type and mtgA-modified strains

  • Real-time Monitoring of Cell Wall Integrity:

    • Implement FRET-based reporters for peptidoglycan stress responses

    • Use fluorescent D-amino acids to label sites of active peptidoglycan synthesis

    • Monitor changes in labeling patterns upon antibiotic treatment

  • Synergy Testing:

    • Employ checkerboard assays to test interactions between antibiotics targeting different steps of cell wall biosynthesis

    • Calculate fractional inhibitory concentration indices to quantify synergistic or antagonistic effects

By systematically implementing these approaches, researchers can establish whether mtgA contributes to intrinsic resistance, adaptive responses, or compensation mechanisms against cell wall-active antibiotics.

What are the most promising future research directions for understanding mtgA function in plant pathogenic bacteria?

Future research on mtgA in plant pathogenic bacteria should focus on integrating glycosyltransferase activity with broader aspects of bacterial physiology and pathogenesis:

  • Comparative Genomics and Evolution:

    • Analyze mtgA sequence conservation across diverse plant pathogens

    • Identify potential horizontal gene transfer events that shaped mtgA evolution

    • Examine co-evolution with other peptidoglycan synthesis machinery

  • Systems Biology Approaches:

    • Map the protein interaction network of mtgA using proximity labeling techniques

    • Identify regulatory factors that control mtgA expression under different conditions

    • Develop mathematical models of peptidoglycan synthesis incorporating mtgA activity

  • Host-Pathogen Interactions:

    • Investigate whether plant immune receptors recognize peptidoglycan synthesized by mtgA

    • Determine if mtgA activity is modulated during different infection stages

    • Explore potential for mtgA-targeted antimicrobial strategies

  • Biotechnological Applications:

    • Develop mtgA-based biosensors for antibiotics that affect peptidoglycan synthesis

    • Engineer modified peptidoglycan structures with novel properties

    • Explore mtgA as a target for sustainable crop protection strategies

These research directions would benefit from emerging technologies such as CRISPR-Cas genome editing for precise genetic manipulation, advanced imaging techniques for visualizing peptidoglycan synthesis in real-time, and synthetic biology approaches for reconstituting minimal peptidoglycan synthesis systems.

How can contradictory findings regarding mtgA function be reconciled through careful experimental design?

Addressing contradictory findings about mtgA function requires systematic investigation of factors that may contribute to discrepancies:

  • Strain-Specific Differences:

    • Compare mtgA function across multiple strains of P. carotovorum

    • Sequence mtgA and associated genes to identify polymorphisms

    • Perform complementation studies exchanging mtgA variants between strains

  • Experimental Condition Variables:

    • Develop standardized growth and assay conditions for cross-laboratory comparison

    • Test mtgA function across a matrix of conditions (temperature, pH, osmolarity)

    • Document detailed protocols to ensure reproducibility

  • Methodological Approach Comparison:

    • Directly compare in vivo versus in vitro approaches for studying mtgA function

    • Validate key findings using multiple independent techniques

    • Examine whether different fusion tags affect protein function

  • Multi-laboratory Validation Studies:

    • Establish collaborative projects to replicate key experiments across different laboratories

    • Share materials (strains, plasmids, antibodies) to minimize technical variables

    • Implement blinded experimental designs for unbiased assessment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.