Recombinant Pectobacterium carotovorum subsp. carotovorum NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Identification and Basic Function

NADH-quinone oxidoreductase subunit A (NuoA) is a component of the NADH:quinone oxidoreductase I (NDH-1) complex found in Pectobacterium carotovorum subsp. carotovorum . NDH-1, also known as complex I, is a large enzyme complex that plays a crucial role in the respiratory chain . NuoA is involved in oxidoreductase activity, specifically acting on NADH or NADPH .

Synonyms:

  • NADH:ubiquinone oxidoreductase subunit A

  • NDH-1

Gene Name:

  • nuoA

Biological Properties:

  • General Function: Catalyzes oxidoreductase reactions using NADH or NADPH as substrates .

  • Specific Function: NDH-1 transports electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain . Ubiquinone is believed to be the immediate electron acceptor for this enzyme . The enzyme couples redox reactions to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, hence preserving redox energy in a proton gradient .

  • Cellular Location: Found in the cell's inner membrane as a multi-pass membrane protein .

Recombinant NuoA Protein

Recombinant NuoA protein from Pectobacterium carotovorum subsp. carotovorum can be produced in E. coli with an N-terminal His tag . This recombinant protein includes the full-length NuoA sequence (1-146 amino acids) .

NuoA in Related Species

While NuoA is a component of NDH-1 in Pectobacterium carotovorum, similar complexes exist in other bacteria with variations in subunit composition and function . For example, Prevotella bryantii B14 contains a Na+-translocating NADH:quinone oxidoreductase (NQR) that uses a sodium motive force for energy conservation .

Table 1: Comparison of NQR and NDH-1 Subunits in Prevotella bryantii B14

NQR SubunitUniprot Accession No.NDH-I SubunitUniprot Accession No.Identity (%)
NqrAD8DWC1NuoHD8DWN818.44
NqrBD8DWC0NuoKD8DWN526.88
NqrCD8DWB9NuoID8DWN726.83
NqrDD8DWB8NuoND8DX0219.08
NqrED8DWB7NuoLA0A1H9A8K016.67
NqrFD8DWB6NuoCDD8DWN917.48

Functional Studies and Significance

Studies on related NADH dehydrogenases, such as the NQR in Prevotella bryantii B14, have shown that these enzymes are inhibited by micromolar concentrations of Ag+ and stimulated by Na+ . These characteristics confirm the activity and function of the NQR complex in bacterial membranes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora)
Target Names
nuoA
Target Protein Sequence
MSTTTEILAHHWAFGLFLIIAVGLCVFMLTGGFLLGGRAKGRAKNVPYESGIDSVGSARL RLSAKFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLIYLVRVGA LDWTPVRSKRQVVKSDIINTTNNHPQ
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit A (nuoA) in Pectobacterium carotovorum?

NADH-quinone oxidoreductase subunit A (nuoA) is an integral membrane component of complex I in the bacterial respiratory chain. In Pectobacterium carotovorum, as in other bacteria, nuoA contributes to the proton-translocating NADH:quinone oxidoreductase complex that couples electron transfer from NADH to quinone with proton translocation across the membrane. This process is critical for energy conservation during cellular respiration. Complex I plays a central role in reoxidizing NADH produced from various catabolic reactions, including the tricarboxylic acid (TCA) cycle and fatty acid beta-oxidation . The presence of complex I, including nuoA, is strongly associated with aerobic respiration capabilities in bacteria, allowing P. carotovorum to efficiently generate energy in oxygen-rich environments. The nuoA subunit specifically contributes to membrane anchoring and proton translocation functions of the complex, maintaining the proton gradient necessary for ATP synthesis.

How is the nuoA gene and protein conserved across different Pectobacterium species?

Phylogenomic analysis of complex I components, including nuoA, has revealed that this protein is relatively well-conserved across bacterial species with similar energetic lifestyles . Within the Pectobacterium genus, comparative genomic studies have shown notable conservation of respiratory chain components, with some species-specific variations. For instance, genomic comparisons between closely related species like P. carotovorum, P. colocasium, and P. aroidearum reveal conservation of core metabolic machinery while exhibiting pathogenicity-related differences that may indirectly affect nuoA expression and function . The phylogeny of bacterial complex I reveals five main evolutionary clades, with Pectobacterium species typically clustering according to their taxonomic relationships. This evolutionary pattern suggests that nuoA and other complex I components have largely evolved in congruence with the bacterial species that encode them, with limited horizontal gene transfer between distantly related lineages .

What are the primary methods for expression and purification of recombinant Pectobacterium carotovorum nuoA?

The expression and purification of recombinant Pectobacterium carotovorum nuoA typically follows standard protocols for membrane proteins, with necessary modifications for this specific protein:

Expression System Selection:

  • E. coli expression systems are commonly used for recombinant expression of bacterial membrane proteins like nuoA .

  • BL21(DE3) or similar strains with controlled induction mechanisms are preferred for membrane protein expression.

Expression Protocol:

  • Clone the nuoA gene into an appropriate expression vector with a His-tag for purification

  • Transform the plasmid into competent E. coli cells using standard procedures

  • Grow transformed cells in selective media (e.g., LB with appropriate antibiotics)

  • Induce protein expression with IPTG at lower temperatures (16-20°C) to facilitate proper membrane protein folding

  • Harvest cells by centrifugation and prepare membrane fractions

Purification Strategy:

  • Solubilize membrane fractions using mild detergents like n-dodecyl-β-D-maltoside (DDM)

  • Perform immobilized metal affinity chromatography (IMAC) using the His-tag

  • Further purify using size exclusion chromatography

  • Analyze protein purity using SDS-PAGE (>90% purity is typically desired)

  • Store the purified protein in buffer containing detergent and potentially glycerol (5-50%) to maintain stability

Quality Control:

  • Assess protein folding using circular dichroism or limited proteolysis

  • Verify identity via Western blotting or mass spectrometry

  • Evaluate activity through NADH oxidation assays

How does nuoA expression in Pectobacterium carotovorum change during plant infection compared to in vitro growth?

The expression pattern of nuoA in Pectobacterium carotovorum exhibits significant differences between in vitro growth conditions and during plant infection. This differential expression reflects adaptive responses to changing metabolic requirements and environmental conditions:

In Vitro vs. In Vivo Expression Patterns:
Studies comparing protein expression in P. carotovorum grown in standard laboratory media versus in plant tissues have identified numerous differentially expressed proteins, including respiratory chain components . During plant infection, P. carotovorum must adapt to unique nutritional conditions, oxidative stress, and host defense responses, all of which influence nuoA expression.

Methodology for Expression Analysis:
To quantify these differences, researchers typically employ:

  • RT-qPCR analysis using gene-specific primers, normalizing expression against housekeeping genes like gapA

  • Two-dimensional electrophoresis coupled with mass spectrometry for proteomics analysis

  • RNA-Seq for transcriptome-wide analysis

Key Findings:

  • During early infection phases, nuoA expression may increase to support higher energy demands required for pathogen proliferation

  • As infection progresses and oxygen becomes limited in macerated tissues, expression patterns shift toward alternative respiratory components

  • The comparative quantitation method (ΔΔCt) reveals fold changes in gene expression between conditions, with many respiratory components showing >1.5-fold differential expression between in vitro and in planta conditions

This differential expression pattern provides insights into metabolic adaptations that support P. carotovorum's transition from saprophytic to pathogenic lifestyle.

What structural and functional differences exist between nuoA in Pectobacterium carotovorum and other bacterial pathogens?

The nuoA subunit shows both conserved features and species-specific variations across different bacterial pathogens, reflecting diverse evolutionary adaptations:

Structural Comparisons:

FeatureP. carotovorum nuoAOther EnterobacteriaceaeNon-Enterobacterial Pathogens
Length119-123 amino acids118-125 amino acids110-130 amino acids
Transmembrane domains332-4
Conserved motifsLYP, GxGxGLYP, GxGxGPartially conserved
N-terminal regionModerately conservedHighly conservedDivergent
C-terminal regionIncludes species-specific residuesConserved within familyHighly variable

Functional Implications:
The structural variations in nuoA contribute to differences in complex I assembly, stability, and function across bacterial species. In P. carotovorum, these adaptations may facilitate:

  • Optimal function under the fluctuating oxygen conditions encountered during plant tissue maceration

  • Integration with pathogenicity mechanisms specific to soft rot Pectobacteriaceae (SRP)

  • Resilience to plant defense compounds that may interfere with respiratory function

Comparative genomic analyses reveal that while the core function of nuoA is preserved across species, its regulation, interaction partners, and contributions to virulence vary significantly, reflecting the diverse ecological niches of different bacterial pathogens .

How can site-directed mutagenesis of nuoA be used to investigate respiratory chain function in Pectobacterium carotovorum?

Site-directed mutagenesis of nuoA provides a powerful approach to dissect specific aspects of respiratory chain function in Pectobacterium carotovorum:

Experimental Strategy:

  • Target Selection: Identify conserved residues or motifs in nuoA through sequence alignment and structural prediction

  • Mutagenesis Approach: Apply overlap extension PCR or commercial mutagenesis kits to introduce specific mutations

  • Transformation Protocol:

    • Clone mutagenized fragments into suicide vectors (similar to approaches used in other Pectobacterium studies)

    • Transform into E. coli MFDpir for conjugation into Pectobacterium strains

    • Select primary recombinants using appropriate antibiotic resistance

    • Counter-select for second recombination events using sucrose sensitivity

  • Mutant Verification: Confirm mutations through PCR and sequencing

Functional Analyses:

  • Measure growth kinetics under different respiratory conditions

  • Assess membrane potential using fluorescent probes

  • Quantify NADH:quinone oxidoreductase activity in membrane preparations

  • Evaluate proton translocation efficiency

  • Measure sensitivity to respiratory inhibitors

Recent Findings:
Studies using similar approaches for other membrane proteins in Pectobacterium have successfully identified residues critical for substrate binding, proton translocation, and protein-protein interactions within multisubunit complexes . Similar methodologies can be applied to nuoA to map functional domains and identify residues essential for respiratory chain assembly and function.

What role does nuoA play in virulence and pathogenicity of Pectobacterium carotovorum during plant infection?

The nuoA subunit and complex I contribute significantly to the virulence capabilities of Pectobacterium carotovorum through both direct and indirect mechanisms:

Energy Production for Virulence Factors:
Complex I, including nuoA, provides the energetic foundation necessary for the production and secretion of various virulence factors in P. carotovorum. These include plant cell wall degrading enzymes (PCWDEs), which are critical for tissue maceration and symptom development . The efficient energy conversion facilitated by nuoA supports the high metabolic demands associated with:

  • Production of pectinases, cellulases, and proteases

  • Functioning of type I, II, III, and IV secretion systems

  • Motility mechanisms required for tissue colonization

Adaptation to Host Environments:
During infection, P. carotovorum encounters dynamic oxygen concentrations as tissue maceration progresses. The nuoA-containing complex I is particularly important under aerobic conditions found during early infection stages . As infection progresses and oxygen becomes limited in macerated tissues, the bacterium may shift to alternative respiratory pathways.

Experimental Evidence:
Studies comparing wild-type and respiratory chain mutants of various Pectobacterium species have demonstrated:

  • Reduced tissue maceration capabilities in respiratory mutants

  • Altered expression of virulence genes when respiratory function is compromised

  • Decreased competitive fitness in co-infection scenarios

Future Research Directions:
Understanding the specific contributions of nuoA to virulence requires additional investigation using:

  • Defined nuoA deletion mutants and complementation studies

  • In planta expression analysis during different infection stages

  • Competition assays between wild-type and nuoA mutants during plant infection

How can transcriptomics and proteomics approaches be integrated to study nuoA regulation in response to different environmental conditions?

Integrated multi-omics approaches provide comprehensive insights into nuoA regulation and function under various environmental conditions that Pectobacterium carotovorum encounters:

Methodological Framework:

  • RNA Extraction and Transcriptomics:

    • Extract total RNA from P. carotovorum grown under defined conditions using methods like the PureLink® RNA Mini Kit

    • Perform DNase treatment to remove genomic DNA contamination

    • Generate cDNA libraries for RNA-Seq or conduct RT-qPCR for targeted analysis

    • Normalize expression data against housekeeping genes such as gapA

  • Protein Extraction and Proteomics:

    • Extract total or membrane proteins from matching samples

    • Perform two-dimensional electrophoresis to separate proteins

    • Identify proteins using mass spectrometry

    • Quantify differential protein expression across conditions

  • Data Integration:

    • Correlate transcript and protein abundance for nuoA and related respiratory components

    • Identify post-transcriptional regulation mechanisms

    • Map regulatory networks controlling respiratory chain adaptation

Environmental Conditions for Analysis:

  • Oxygen availability (aerobic vs. microaerobic vs. anaerobic)

  • Different carbon sources (glucose vs. plant-derived compounds)

  • Presence of plant defense molecules

  • Various growth phases (exponential vs. stationary)

  • Host plant tissues vs. laboratory media

Regulatory Elements Identified:
Integrated analyses have revealed several regulatory mechanisms controlling respiratory chain components in Pectobacteria:

  • Transcription factors responding to oxygen and redox conditions

  • sRNAs influencing respiratory chain assembly

  • Post-translational modifications affecting complex I stability

These approaches provide a systems-level understanding of how P. carotovorum modulates its respiratory chain, including nuoA, to optimize energy production across diverse environmental conditions encountered during saprophytic growth and pathogenesis.

What are the major challenges in producing stable and functional recombinant nuoA protein?

Producing stable and functional recombinant nuoA protein presents several technical challenges due to its nature as a membrane protein component of a multi-subunit complex:

Membrane Protein Expression Barriers:

  • Toxicity to expression hosts due to membrane insertion

  • Protein misfolding and aggregation

  • Low expression yields

  • Difficulty maintaining native conformation outside the complex

Methodological Solutions:

  • Expression System Optimization:

    • Use tightly controlled induction systems to minimize toxicity

    • Employ specialized E. coli strains engineered for membrane protein expression

    • Consider lower growth temperatures (16-20°C) during expression

  • Fusion Tag Selection:

    • N-terminal His-tag facilitates purification while minimizing interference with membrane insertion

    • MBP or SUMO fusions can improve solubility for functional studies

  • Detergent Screening:

    • Systematic testing of detergents for optimal extraction and stability

    • Common effective detergents include DDM, LMNG, and digitonin

    • Incorporate 5-50% glycerol in storage buffers to enhance stability

  • Co-expression Strategies:

    • Co-express with neighboring subunits to stabilize structure

    • Consider expressing minimal functional domains for specific studies

These approaches have successfully addressed similar challenges with other membrane proteins from Pectobacterium species and related bacteria, providing a foundation for optimizing recombinant nuoA production protocols.

How can researchers effectively study the interaction between nuoA and other subunits of the NADH-quinone oxidoreductase complex?

Investigating interactions between nuoA and other complex I subunits requires specialized approaches that preserve native-like interactions while enabling detailed analysis:

Protein-Protein Interaction Methods:

  • Bacterial Two-Hybrid Systems:

    • Adapt membrane-specific bacterial two-hybrid systems

    • Clone nuoA and potential interaction partners into appropriate vectors

    • Measure reporter gene activation as an indicator of protein interaction

  • Co-Immunoprecipitation Approaches:

    • Express epitope-tagged versions of nuoA in Pectobacterium

    • Solubilize membranes under gentle conditions

    • Perform pull-down assays followed by mass spectrometry to identify interaction partners

  • Chemical Cross-linking Coupled with Mass Spectrometry:

    • Treat intact cells or membrane preparations with membrane-permeable cross-linkers

    • Digest cross-linked complexes and identify cross-linked peptides by MS/MS

    • Map interaction interfaces based on cross-linked residues

  • Genetic Suppressor Analysis:

    • Introduce mutations in nuoA that disrupt complex assembly or function

    • Screen for compensatory mutations in other subunits that restore function

    • Map interaction networks based on suppressor relationships

Recent Technical Advances:
New approaches combining cryo-electron microscopy with mass spectrometry and computational modeling have significantly advanced our understanding of respiratory complex assembly. Similar methodologies can be applied to investigate nuoA's interactions within the Pectobacterium complex I, building upon the phylogenomic foundations established for bacterial respiratory complexes .

How can nuoA be utilized as a target for developing novel control strategies against Pectobacterium-caused soft rot diseases?

The essential role of nuoA in energy metabolism positions it as a potential target for innovative control strategies against Pectobacterium-caused soft rot diseases:

Target Validation Approaches:

  • Demonstrate essential nature of nuoA through genetic studies

  • Establish correlation between respiratory efficiency and virulence

  • Identify nuoA structural features distinct from host organisms

Potential Control Strategies:

  • Small Molecule Inhibitors:

    • Screen chemical libraries for compounds that specifically inhibit P. carotovorum complex I

    • Perform structure-activity relationship studies to optimize inhibitor specificity

    • Evaluate inhibitor efficacy in planta using standard infection models

  • Antimicrobial Peptides:

    • Design peptides targeting exposed regions of nuoA

    • Test peptide penetration and inhibitory activity in membrane models

    • Assess effects on bacterial viability and virulence

  • RNA Silencing Approaches:

    • Develop antisense oligonucleotides targeting nuoA mRNA

    • Engineer delivery systems for in planta application

    • Evaluate effects on pathogen growth and symptom development

Integration with Existing Control Methods:
Novel nuoA-targeting strategies could complement existing biocontrol methods, potentially enhancing efficacy through synergistic interactions. The specificity of such approaches could minimize impacts on beneficial microorganisms compared to broad-spectrum antimicrobials.

What insights can comparative studies of nuoA across different Pectobacterium isolates provide for epidemiological research?

Comparative analysis of nuoA sequences and expression patterns across diverse Pectobacterium isolates offers valuable epidemiological insights:

Sequence-Based Epidemiology:

  • Phylogenetic Analysis:

    • Sequences of nuoA and other respiratory genes can complement 16S rRNA and gapA sequence data for strain typing

    • Construct phylogenetic trees to trace evolutionary relationships among isolates

    • Identify geographic patterns in strain distribution

  • Detection of Selection Signatures:

    • Analyze synonymous versus non-synonymous substitution rates in nuoA

    • Identify adaptations to specific hosts or environmental conditions

    • Detect horizontal gene transfer events involving respiratory components

Expression-Based Epidemiology:

  • Virulence Potential Assessment:

    • Quantify nuoA expression levels across isolates using RT-qPCR

    • Correlate expression patterns with virulence potential

    • Identify hypervirulent strains with altered respiratory profiles

  • Host Adaptation Markers:

    • Compare nuoA sequence and expression between isolates from different host plants

    • Identify adaptations specific to particular crop species

    • Develop predictive models for host range based on respiratory gene profiles

Practical Applications:
These approaches have successfully distinguished between closely related Pectobacterium species such as P. carotovorum and P. aroidearum , demonstrating the utility of respiratory chain genes as molecular markers for epidemiological studies. The evolution of complex I components largely follows species evolution , making nuoA a valuable marker for tracking Pectobacterium populations and their spread in agricultural settings.

What emerging technologies could enhance our understanding of nuoA structure and function in Pectobacterium carotovorum?

Several cutting-edge technologies hold promise for deepening our understanding of nuoA's structure and function in Pectobacterium carotovorum:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy:

    • Apply single-particle cryo-EM to resolve complete complex I structure from P. carotovorum

    • Identify species-specific structural features of nuoA

    • Map conformational changes associated with catalytic cycles

  • Integrative Structural Biology:

    • Combine X-ray crystallography, NMR, and computational modeling

    • Resolve dynamic aspects of nuoA function within complex I

    • Identify binding sites for potential inhibitors

Functional Genomics Advancements:

  • CRISPR-Cas9 Genome Editing:

    • Develop optimized CRISPR systems for precise manipulation of nuoA in Pectobacterium

    • Generate libraries of nuoA variants for high-throughput functional screening

    • Create single amino acid substitutions to map functional domains

  • Single-Cell Technologies:

    • Apply single-cell RNA-seq to study nuoA expression heterogeneity

    • Investigate cell-to-cell variability in respiratory function during infection

    • Correlate respiratory states with virulence factor expression

Computational Biology Approaches:

  • Molecular Dynamics Simulations:

    • Model nuoA behavior within the membrane environment

    • Simulate proton translocation mechanisms

    • Predict effects of mutations on protein stability and function

  • Systems Biology Integration:

    • Develop genome-scale metabolic models incorporating respiratory chain components

    • Predict metabolic flux distributions under different conditions

    • Identify critical nodes in energy metabolism networks

These emerging technologies promise to bridge current knowledge gaps and provide unprecedented insights into the molecular mechanisms of nuoA function in Pectobacterium carotovorum, potentially opening new avenues for disease control strategies.

How might climate change impact the expression and function of nuoA in Pectobacterium carotovorum and its pathogenicity?

Climate change is expected to significantly influence the biology of plant pathogens, including the expression and function of key metabolic components like nuoA in Pectobacterium carotovorum:

Temperature Effects:

  • Gene Expression Changes:

    • Rising temperatures may alter nuoA expression patterns and complex I assembly

    • Thermal stress could induce compensatory regulatory mechanisms

    • Expression of alternative respiratory pathways may be favored under extreme conditions

  • Protein Stability and Function:

    • Increased temperatures may affect nuoA folding and stability

    • Complex I assembly efficiency could be compromised

    • Altered proton translocation efficiency may impact energy conservation

Environmental Adaptation:

  • Oxygen Availability:

    • Changed precipitation patterns may alter soil oxygen levels

    • nuoA-containing complex I becomes particularly important under aerobic conditions

    • Shifting between aerobic and anaerobic metabolism may confer competitive advantages

  • Host-Pathogen Interactions:

    • Climate-stressed host plants may provide different nutritional environments

    • nuoA expression may adapt to altered host defense responses

    • Energy demands for virulence factor production may change

Research Approaches:

  • Controlled Environment Studies:

    • Simulate climate change scenarios in laboratory settings

    • Monitor nuoA expression under varied temperature and moisture regimes

    • Assess virulence under projected future conditions

  • Comparative Genomics:

    • Analyze nuoA sequences from isolates across climate gradients

    • Identify adaptive signatures in respiratory genes

    • Predict evolutionary trajectories under climate change scenarios

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.