Recombinant Pectobacterium carotovorum subsp. carotovorum NADH-quinone oxidoreductase subunit K (nuoK)

What experimental approaches are recommended for expressing and purifying recombinant nuoK protein?

Successful expression and purification of recombinant nuoK requires specialized approaches due to its highly hydrophobic nature and multiple transmembrane domains. The recommended methodology includes:

• Expression system selection: E. coli is commonly used for heterologous expression of bacterial membrane proteins, as demonstrated for the R. solanacearum nuoK . For P. carotovorum nuoK, similar approaches can be applied with strain-specific optimizations.

• Vector design: Incorporate an affinity tag (commonly His-tag) at the N-terminus to facilitate purification while minimizing interference with protein folding .

• Expression conditions:

  • Use lower temperatures (16-25°C) to reduce inclusion body formation

  • Induce with lower IPTG concentrations (0.1-0.5 mM)

  • Consider specialized media formulations for membrane protein expression

• Membrane extraction: Utilize gentle detergents (DDM, LDAO, or C12E8) for solubilization from membrane fractions.

• Purification protocol:

  • Immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography for increased purity

  • Maintain detergent above critical micelle concentration throughout

• Storage consideration: Store in buffer containing 50% glycerol with appropriate detergent at -20°C/-80°C to maintain stability .

The final product should be verified by SDS-PAGE (>90% purity) and can be lyophilized for long-term storage with appropriate cryoprotectants like trehalose .

How does nuoK expression change under different environmental conditions relevant to plant infection?

The expression patterns of nuoK in Pectobacterium carotovorum vary significantly depending on environmental conditions, especially those that mimic plant infection scenarios. Proteomic analyses comparing in vitro and in vivo growth conditions have demonstrated differential expression patterns for numerous proteins involved in energy metabolism and virulence .

While nuoK-specific expression data is limited in the available research, studies of P. carotovorum proteomics provide valuable insights into how respiratory chain components respond to plant-associated environments. The expression patterns likely follow those of other energy metabolism proteins, which show significant upregulation during plant colonization compared to standard laboratory media .

Experimental approaches to study nuoK expression should include quantitative RT-PCR, reporter gene fusions (e.g., nuoK-GFP), and comparative proteomics under different growth conditions .

What methodologies are most effective for investigating nuoK's role in the NADH-quinone oxidoreductase complex assembly?

Investigating nuoK's role in NADH-quinone oxidoreductase complex assembly requires a multi-faceted approach combining structural, biochemical, and genetic techniques:

• Site-directed mutagenesis: Systematically introduce mutations in conserved residues to identify those critical for complex assembly and function. Focus on the transmembrane regions and residues involved in subunit interactions.

• Bacterial two-hybrid assays: Identify protein-protein interactions between nuoK and other subunits of the complex to map interaction domains.

• Blue Native PAGE: Analyze the impact of nuoK mutations or deletion on complex I assembly and stability in membrane preparations.

• Cryo-electron microscopy: Determine the structural organization of the complete complex with particular focus on nuoK's position and interactions.

• In vivo crosslinking: Capture transient interactions during complex assembly using chemical crosslinkers followed by mass spectrometry analysis.

• Complementation studies: Express wild-type or mutant nuoK variants in nuoK-deficient strains to evaluate restoration of complex assembly and function.

• Comparative structural analysis: Utilize the amino acid sequence (MIPLQHGLILAAILFVLGLTGLLIRRNLLFmLISLEIMINAAALAFVVAGSYWQQPDGQVMYILAITLAAAAEASIGLALLLQMYRRRQTLNIDTVSEMRG) to model the structure and predict interaction interfaces .

These approaches should be combined with functional assays measuring NADH oxidation activity and proton pumping efficiency to correlate structural findings with functional outcomes.

How might nuoK contribute to the virulence and pathogenicity of Pectobacterium carotovorum?

While direct evidence linking nuoK to virulence in Pectobacterium carotovorum is not explicitly documented in the provided search results, its potential contributions to pathogenicity can be inferred from its function and studies of related systems:

• Energy production for virulence factor synthesis: As a component of the respiratory chain, nuoK contributes to ATP generation needed for the production and secretion of virulence factors such as plant cell wall-degrading enzymes and bacteriocins like Carocin S4 .

• Adaptation to plant microenvironments: The electron transport chain, including nuoK, may help bacteria adapt to varying oxygen levels and nutrient conditions encountered during plant infection.

• Indirect support of virulence systems: Genome comparison studies have revealed that most virulence genes are highly conserved in Pectobacterium strains, and energy metabolism genes like nuoK provide the necessary cellular energy for these systems .

• Potential parallels with identified virulence factors: Studies have identified several proteins that, when mutated, lead to reduced virulence in P. carotovorum, including ClpP, MreB, FlgK, and Eda . While nuoK was not specifically identified in these studies, other metabolic proteins have been linked to virulence.

Experimental approaches to investigate nuoK's role in virulence would include:

• Construction of nuoK deletion mutants and assessment of virulence in plant models

• Transcriptome analysis comparing wild-type and nuoK mutants during infection

• Metabolic profiling to determine how nuoK impacts energy production during infection processes

How do mutations in conserved domains of nuoK affect electron transport efficiency and bacterial fitness?

• Identification of conserved domains: Based on the amino acid sequence provided (MIPLQHGLILAAILFVLGLTGLLIRRNLLFmLISLEIMINAAALAFVVAGSYWQQPDGQVMYILAITLAAAAEASIGLALLLQMYRRRQTLNIDTVSEMRG), key conserved regions include transmembrane helices and residues involved in quinone binding or proton translocation .

• Mutational effects matrix:

• Measurement approaches:

  • Oxygen consumption rates to assess respiratory capacity

  • NAD+/NADH ratio measurements to evaluate electron transfer efficiency

  • Membrane potential assessments using fluorescent probes

  • Growth rate analysis under various carbon sources and oxygen conditions

  • Competition assays to determine fitness costs in mixed cultures

• In vivo relevance: Mutations that severely impair nuoK function would likely affect virulence by reducing the energy available for pathogenicity mechanisms, particularly under the challenging conditions encountered during plant infection .

The most critical mutations would likely be those affecting the conserved residues shared between P. carotovorum nuoK and related bacterial species, as these represent evolutionarily essential structural and functional elements of the protein.

What computational approaches can be used to model nuoK structure and predict its interactions within the larger respiratory complex?

Advanced computational approaches for modeling nuoK structure and its interactions within the respiratory complex involve multiple complementary methods:

• Homology modeling: Using the amino acid sequence of P. carotovorum nuoK (MIPLQHGLILAAILFVLGLTGLLIRRNLLFmLISLEIMINAAALAFVVAGSYWQQPDGQVMYILAITLAAAAEASIGLALLLQMYRRRQTLNIDTVSEMRG), construct models based on solved structures of homologous proteins, particularly from bacterial respiratory complexes with available structural data .

• Ab initio modeling: For regions without suitable templates, employ physics-based modeling approaches like Rosetta membrane protein modeling.

• Molecular dynamics simulations: Embed the modeled nuoK structure in a lipid bilayer environment and simulate its behavior to refine the structural model and identify stable conformations.

• Protein-protein docking: Predict interactions between nuoK and other Complex I subunits using tools like HADDOCK or ClusPro with constraints derived from evolutionary conservation and experimental crosslinking data.

• Coevolutionary analysis: Apply methods like Direct Coupling Analysis (DCA) to identify residue pairs that have coevolved, suggesting physical proximity or functional relationships between subunits.

• Quantum mechanical calculations: For the active sites and electron transfer pathways, employ QM/MM approaches to model electronic properties.

• Integration with experimental data: Validate and refine computational models using:

  • Crosslinking-mass spectrometry data

  • Cryo-EM density maps

  • Mutagenesis results

  • Evolutionary conservation patterns

These computational approaches should be integrated into an iterative workflow where experimental validation informs model refinement, ultimately producing a comprehensive structural and functional understanding of nuoK's role in the respiratory complex.

How can nuoK be exploited as a potential target for developing antimicrobials against Pectobacterium plant pathogens?

Targeting nuoK for antimicrobial development against Pectobacterium carotovorum presents a promising research direction due to its essential role in bacterial energy metabolism. A comprehensive strategy would include:

• Target validation:

  • Generate conditional nuoK mutants to confirm its essentiality under infection-relevant conditions

  • Assess growth and virulence phenotypes of nuoK-depleted strains in planta

  • Evaluate potential for resistance development through adaptive laboratory evolution

• Druggable site identification:

  • Analyze the nuoK amino acid sequence (MIPLQHGLILAAILFVLGLTGLLIRRNLLFmLISLEIMINAAALAFVVAGSYWQQPDGQVMYILAITLAAAAEASIGLALLLQMYRRRQTLNIDTVSEMRG) to identify potential binding pockets

  • Focus on regions that differ from mammalian or plant homologs to ensure specificity

  • Consider targeting protein-protein interaction interfaces within the NADH-quinone oxidoreductase complex

• Screening approaches:

  • Structure-based virtual screening against modeled nuoK structure

  • Fragment-based screening using thermal shift assays

  • Whole-cell phenotypic screening with respiratory readouts

• Compound optimization workflow:

• Delivery considerations:

  • Formulation strategies for plant application

  • Systemic vs. contact activity assessment

  • Stability under field conditions

  • Eco-toxicological profiling

This approach leverages the understanding that effective plant protection against bacterial pathogens requires novel targets, especially as no currently effective methods exist for controlling Pectobacterium diseases . Targeting bacterial respiration through nuoK provides a mechanistically distinct approach compared to traditional antimicrobials.

How can recombinant nuoK be utilized for developing specific antibodies or diagnostic tools for Pectobacterium detection?

Recombinant nuoK from Pectobacterium carotovorum offers significant potential as a target for developing specific antibodies and diagnostic tools, with applications in both research and agricultural disease management:

• Antibody development pipeline:

  • Express and purify recombinant nuoK protein with appropriate tags for enhanced solubility

  • Utilize the purified protein for immunization protocols (rabbit polyclonal or mouse monoclonal)

  • Screen antibodies for specificity against P. carotovorum versus related bacteria

  • Validate antibodies in multiple detection formats (ELISA, immunofluorescence, western blot)

• Diagnostic application development:

  • ELISA-based detection systems using anti-nuoK antibodies for field sampling

  • Lateral flow immunoassays for rapid on-site detection

  • Immunomagnetic separation techniques for bacteria concentration from plant samples

• Sensitivity and specificity considerations:

• Epitope selection strategy:

  • Identify unique, surface-exposed regions in the nuoK sequence that differ from related species

  • Consider synthetic peptide approaches for membrane-embedded proteins

  • Focus on regions that show conservation within P. carotovorum but variation from other Pectobacterium species

• Validation requirements:

  • Cross-reactivity testing against related plant pathogens

  • Sensitivity determination in various plant matrices

  • Stability testing under field conditions

  • Comparison with established detection methods (PCR, traditional plating)

When developing these tools, researchers should consider the amino acid sequence variability between nuoK proteins of different Pectobacterium strains to ensure broad detection capabilities while maintaining specificity .

What can comparative analysis of nuoK across Pectobacterium species reveal about respiratory chain evolution and host adaptation?

Comparative analysis of nuoK across Pectobacterium species provides valuable insights into respiratory chain evolution and host adaptation mechanisms, revealing how this essential cellular component has diversified during pathogen evolution:

• Evolutionary rate analysis:

  • Compare substitution rates in nuoK versus other respiratory complex subunits

  • Identify rapidly evolving sites that may reflect host-specific adaptation

  • Determine if nuoK evolution correlates with host range or virulence characteristics

• Selective pressure mapping:

  • Calculate dN/dS ratios to identify sites under positive selection

  • Map these sites to structural features of nuoK to understand functional implications

  • Correlate selection patterns with ecological niches of different Pectobacterium species

• Comparative sequence analysis framework:

• Structural biology implications:

  • Model the effects of sequence variations on protein folding and stability

  • Identify substitutions affecting proton translocation or quinone binding

  • Evaluate how membrane-spanning regions may adapt to different host membrane environments

• Integration with genomic context:

  • Analyze conservation of the operon structure containing nuoK

  • Identify potential horizontal gene transfer events affecting respiratory complexes

  • Examine regulatory elements that may influence nuoK expression in different hosts

This comparative approach reveals how fundamental cellular processes like respiration have been fine-tuned during pathogen evolution. Genome sequencing methodologies similar to those used for P. aroidearum L6 can be applied to generate high-quality data for comparative analysis . The insights gained can help understand how respiratory chain components contribute to ecological fitness across different plant hosts and environmental conditions.

How does the function of nuoK in Pectobacterium compare with homologous proteins in other bacterial plant pathogens?

A comprehensive comparison of nuoK function between Pectobacterium carotovorum and other bacterial plant pathogens reveals important insights into the conservation and specialization of respiratory chain components:

• Biochemical property comparison:

  • Analysis of amino acid compositions reveals how nuoK adaptations reflect the metabolic requirements of different pathogens

  • The P. carotovorum nuoK (MIPLQHGLILAAILFVLGLTGLLIRRNLLFmLISLEIMINAAALAFVVAGSYWQQPDGQVMYILAITLAAAAEASIGLALLLQMYRRRQTLNIDTVSEMRG) shows specific adaptations in its membrane-spanning regions compared to R. solanacearum (MLSLAHYLVLGAVLFAISIVGIFLNRKNVIVLLMAIELMLLAVNMNFVAFSHYLGDLAGQVFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDLDSLKG)

  • These differences likely reflect adaptations to different host environments and infection strategies

• Gene expression regulation:

  • Comparative transcriptomics data suggests nuoK expression patterns vary between pathogens

  • While specific nuoK expression data is limited, broader studies of respiratory proteins indicate pathogen-specific regulation

  • The induction of respiratory genes during plant infection follows distinct patterns in different bacterial groups, reflecting their infection strategies

• Evolutionary implications:

  • The different selective pressures on nuoK across bacterial pathogens provide insights into the evolutionary trajectories of respiratory systems

  • Conservation patterns highlight universally essential functions versus adaptable features

  • These comparisons can inform predictions about nuoK's role in emerging plant pathogens

The functional comparison of nuoK across different bacterial plant pathogens enhances our understanding of how core metabolic processes have been adapted during pathogen evolution while maintaining their essential functions in cellular energetics.

What are the optimal protocols for investigating nuoK protein-protein interactions within the respiratory complex?

Investigating protein-protein interactions involving nuoK requires specialized approaches due to its membrane-embedded nature and integration within a multi-subunit complex. The following methodological framework represents current best practices:

• Crosslinking mass spectrometry (XL-MS):

  • Apply membrane-permeable crosslinkers (DSS, BS3, or EDC)

  • Optimize crosslinking conditions (concentration, time, pH)

  • Digest crosslinked complexes and analyze by LC-MS/MS

  • Identify crosslinked peptides using specialized software (e.g., pLink, xQuest)

  • Map interaction sites to the nuoK sequence (MIPLQHGLILAAILFVLGLTGLLIRRNLLFmLISLEIMINAAALAFVVAGSYWQQPDGQVMYILAITLAAAAEASIGLALLLQMYRRRQTLNIDTVSEMRG)

• Co-immunoprecipitation adaptations for membrane proteins:

  • Express epitope-tagged nuoK variants

  • Solubilize membranes with mild detergents (DDM, digitonin)

  • Perform pulldowns with subunit-specific antibodies

  • Identify binding partners by western blotting or mass spectrometry

  • Validate with reciprocal pulldowns

• FRET/BRET approaches:

  • Generate fluorescent protein fusions (considering membrane topology)

  • Express in bacterial systems with intact respiratory complexes

  • Measure energy transfer between labeled subunits

  • Map interaction networks through systematic labeling strategies

• Split reporter assays:

  • Design split-GFP or split-luciferase constructs fused to nuoK and potential partners

  • Express in appropriate bacterial hosts

  • Quantify complementation signal as measure of interaction

  • Systematically map interaction domains through truncation series

• Experimental conditions optimization matrix:

• Data integration and validation:

  • Combine results from multiple techniques to build interaction maps

  • Validate key interactions through mutagenesis of interface residues

  • Compare experimental results with computational predictions

  • Develop structural models incorporating interaction constraints

These approaches should be applied in an iterative manner, with each round of experiments informing the design of subsequent studies to progressively build a detailed map of nuoK's interactions within the respiratory complex.

What are the most promising future research directions for understanding nuoK function in bacterial plant pathogens?

The study of NADH-quinone oxidoreductase subunit K (nuoK) in Pectobacterium carotovorum and other bacterial plant pathogens presents several high-potential research avenues that could significantly advance our understanding of bacterial energy metabolism and pathogenesis:

• Systems biology integration: Developing comprehensive models that link nuoK function to broader cellular processes including virulence factor production, stress response, and host adaptation. This approach would build on existing proteomic studies that have identified numerous proteins with altered expression during plant infection .

• Structural biology advancements: Applying cryo-electron microscopy and X-ray crystallography to determine high-resolution structures of bacterial Complex I with focus on nuoK's position and interactions. This would complement existing sequence information and computational models based on the amino acid sequence data .

• In planta functional genomics: Developing methods to study nuoK expression and function directly within infected plant tissues, potentially using techniques like dual RNA-seq or in planta proteomics to understand how respiratory components respond during actual infection processes .

• Comparative analysis across pathogen lifestyles: Expanding nuoK studies to include diverse bacterial pathogens with different infection strategies, hosts, and metabolic capabilities to identify common principles and specializations in respiratory chain function.

• Antimicrobial development pipeline: Building on the essential nature of nuoK to develop targeted antimicrobials that specifically disrupt respiratory function in plant pathogens with minimal effects on beneficial microbes or plant hosts.

• Evolutionary adaptation mechanisms: Investigating how nuoK has evolved in response to different plant hosts and environmental conditions, potentially revealing mechanisms of host adaptation at the level of basic cellular metabolism.