Recombinant Pectobacterium carotovorum subsp. carotovorum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pectobacterium carotovorum subsp. carotovorum Prolipoprotein Diacylglyceryl Transferase (Lgt)

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme in bacterial lipoprotein biosynthesis, initiating the lipid modification of prolipoproteins by transferring an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue at position +1 of the mature protein . The recombinant Lgt protein from P. carotovorum subsp. carotovorum is a transmembrane enzyme engineered for research and biotechnological applications.

Key Features:

  • Uniprot ID: C6DAE8

  • Function: Catalyzes the first step in bacterial lipoprotein maturation, essential for virulence and membrane protein integration .

  • Expression Systems: Recombinant Lgt is typically produced in E. coli or other heterologous hosts (e.g., Bacillus subtilis) with N-terminal His-tags for purification .

Membrane Topology and Localization

Lgt is an inner membrane protein, but solubilization studies suggest a peripheral, possibly reversible hydrophobic association with the cytosolic side of the membrane . Key findings include:

  • Topology Determination: Fusions with β-galactosidase and alkaline phosphatase indicate cytosolic localization, contradicting earlier predictions of transmembrane domains .

  • Solubility: Lgt can be extracted from inverted vesicles with water or low ionic solutions, retaining enzymatic activity in soluble form .

Enzymatic Activity and Substrate Specificity

Lgt transfers sn-1,2-diacylglyceryl groups from phosphatidylglycerol to prolipoproteins. Synthetic peptide studies reveal no strict hydrophobicity preference in substrates, explaining the prevalence of hydrophilic signal peptides in bacterial lipoproteins .

Reaction Mechanism:

  1. Transfer: sn-1,2-diacylglyceryl group from phosphatidylglycerol to cysteine +1 of prolipoprotein.

  2. Byproduct: Glycerolphosphate is released .

  3. Subsequent Steps: Signal peptidase II (Lsp) cleaves the signal peptide, and N-acyltransferase (Lnt) adds palmitate to cysteine +1 .

Role in Bacterial Pathogenesis

Lgt is essential for bacterial survival and virulence. lgt depletion in E. coli causes growth defects, confirming its critical role in lipoprotein maturation . In P. carotovorum, lipoproteins contribute to plant cell wall degradation and disease progression .

Complementation Assays

Cysteine/alanine mutants of lgt in E. coli demonstrate the enzyme’s indispensability. Mutants fail to restore growth unless complemented with functional Lgt .

Biochemical Studies

  • Kinetic Behavior: Soluble Lgt retains activity comparable to membrane-bound forms, suggesting aqueous compatibility for enzymatic assays .

  • Substrate Tolerance: Hydrophilic h-regions in prolipoproteins are efficiently modified, challenging traditional substrate specificity models .

Insights into Lipid Modification

  • Heat Stability: Membrane-bound Lgt shows greater heat resistance compared to soluble forms, suggesting structural stabilization in lipid environments .

  • Substrate Flexibility: Synthetic peptides with hydrophilic h-regions are efficiently modified, broadening the scope of lipoprotein engineering .

Challenges in Recombinant Production

  • Folding and Activity: Proper folding in heterologous hosts is critical for enzymatic function. Misfolded Lgt may lack activity despite correct sequence .

  • Membrane Association: Peripheral localization complicates structural studies, requiring innovative solubilization strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
lgt; PC1_0906; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
lgt
Target Protein Sequence
MMTTSYLAFPQFDPVIFSIGPLALHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKDEVEN LLYMGFLGVFVGGRLGYVLFYAFPSFLENPLYLFKVWDGGMSFHGGLMGVICVMLWFAHR TKRHFFQVADFIAPLIPFGLGAGRLGNFINGELWGRVTTDTPWAMLFPGSRSEDMMLAVS NPQWQAIFNQYGMLPRHPSQLYQMMLEGVALFIILNLFIRKSRPMGSVSGLFLIGYGTFR IITEFFRQPDAQLGLFGDLFSMGQILSLPMVIAGILMMVWAYRRQPVQQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its functional role in Pectobacterium carotovorum?

Prolipoprotein diacylglyceryl transferase (lgt) is an enzyme responsible for catalyzing the transfer of a diacylglyceryl group to prolipoproteins in bacteria, including Pectobacterium carotovorum . The enzyme plays a crucial role in lipoprotein anchoring in bacterial cell membranes. In Pectobacterium carotovorum, lgt (UniProt accession: C6DAE8) functions in the lipid modification pathway that allows proper anchoring of various lipoproteins to the bacterial membrane . Similar to what has been demonstrated in other bacterial species, lgt in P. carotovorum is likely exclusively responsible for the lipidation of prolipoproteins, which is essential for proper protein function and bacterial viability .

How does lgt contribute to the pathogenicity of Pectobacterium carotovorum?

Pectobacterium carotovorum is a significant phytopathogen responsible for bacterial soft rot in carrots and other vegetables, causing substantial economic losses . While the specific contribution of lgt to pathogenicity isn't directly detailed in the available research, we can infer its importance based on related bacterial systems. Properly anchored lipoproteins facilitated by lgt activity are likely crucial for the bacterium's ability to colonize plant tissue, resist plant defense mechanisms, and secrete virulence factors . The identification of differentially expressed proteins during infection, potentially including those processed by lgt, is considered important for understanding the infection process and developing effective control strategies .

What is the structure and genomic context of the lgt gene in Pectobacterium carotovorum?

The lgt gene in Pectobacterium carotovorum subsp. carotovorum (strain PC1) is identified by the ordered locus name PC1_0906 . The protein encoded by this gene consists of 289 amino acids with a full sequence as provided in the product information . The amino acid sequence indicates that lgt in P. carotovorum is a membrane protein with multiple transmembrane domains, which is consistent with its function in lipoprotein modification at the membrane interface. The genomic context of lgt in P. carotovorum likely includes genes involved in lipoprotein processing and membrane protein function, though specific information about adjacent genes isn't provided in the available research.

What are the recommended methods for expressing and purifying recombinant Pectobacterium carotovorum lgt?

For expressing and purifying recombinant P. carotovorum lgt, researchers typically employ bacterial expression systems optimized for membrane proteins. Based on available information about the recombinant protein, the purification process likely involves affinity chromatography, though the specific tag type may vary depending on the production process . The purified protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability .

For optimal results, researchers should consider the following methodological approaches:

  • Expression in E. coli strains specialized for membrane protein production

  • Induction optimization to balance protein yield and proper folding

  • Membrane solubilization using appropriate detergents

  • Purification under conditions that maintain native protein conformation

  • Storage at -20°C or -80°C for extended periods, with working aliquots kept at 4°C for up to one week

How can researchers effectively detect and quantify lgt activity in experimental settings?

Detection and quantification of lgt activity can be approached through several complementary methods:

  • Radioisotope labeling: Similar to methods used in Listeria monocytogenes studies, researchers can cultivate bacterial strains in the presence of [14C]palmitic acid and analyze the incorporation of the label into lipoproteins via SDS-PAGE followed by autoradiography . The absence of labeled proteins in lgt deletion mutants confirms the specificity of the labeling process.

  • Immunoblotting: Generation of polyclonal antibodies against purified lgt allows for direct detection of the protein in wild-type strains, mutants, and complemented strains . This approach enables verification of lgt expression levels across different experimental conditions.

  • ELISA-based detection: Using recombinant lgt protein as a standard, researchers can develop quantitative assays for measuring lgt levels in various sample types .

  • Activity assays: In vitro assays measuring the transfer of diacylglyceryl groups to synthetic peptide substrates can provide direct measurement of enzymatic activity.

What considerations are important when designing lgt knockout or mutation studies in Pectobacterium carotovorum?

When designing knockout or mutation studies targeting lgt in P. carotovorum, researchers should consider several critical factors:

  • Gene essentiality assessment: Determine whether lgt is essential for P. carotovorum viability under standard laboratory conditions, as complete deletion may not be viable if the gene is essential.

  • Complementation strategy: Develop a complementation system, such as expressing the wild-type lgt gene from a plasmid under a constitutive promoter, to verify that observed phenotypes are specifically due to lgt disruption .

  • Phenotypic characterization: Assess multiple phenotypes including growth kinetics, membrane integrity, protein mislocalization, and virulence in plant infection models.

  • Lipoprotein profiling: Compare lipoprotein profiles between wild-type and mutant strains using proteomic approaches to identify affected proteins.

  • Conditional mutations: Consider temperature-sensitive or inducible systems if complete deletion proves lethal.

  • Polar effects: Design deletion strategies that minimize effects on downstream genes to ensure phenotypes are specifically attributable to lgt disruption.

How does the function of lgt in Pectobacterium carotovorum compare with homologs in other bacterial species?

Comparative genomic and structural analyses could reveal adaptations specific to the plant pathogen lifestyle. For instance, the amino acid sequence of P. carotovorum lgt (289 residues) suggests multiple transmembrane domains typical of this enzyme family . Deeper comparison with characterized lgt proteins from other bacteria could identify conserved catalytic residues versus variable regions that might relate to substrate specificity or regulatory mechanisms specific to P. carotovorum.

Functional complementation experiments, where lgt from different bacterial species is expressed in P. carotovorum lgt mutants, would provide valuable insights into the degree of functional conservation and potential specialization in this enzyme family.

What is the relationship between lgt activity and bacteriophage resistance in Pectobacterium carotovorum?

An intriguing area for advanced research is the potential relationship between lgt activity and bacteriophage resistance in P. carotovorum. While not directly addressed in the available literature for this specific system, this represents an important avenue for investigation given the emerging interest in phage biocontrol for managing bacterial soft rot disease .

The bacteriophage vB_PcaM_P7_Pc (P7_Pc), characterized as a myovirus with lytic activity against P. carotovorum, offers a valuable tool for such studies . Since many phages recognize and bind to surface proteins for host attachment, and some of these proteins are lipoproteins processed by lgt, there may be a direct relationship between lgt function and phage susceptibility.

Research questions worth exploring include:

  • Does modulation of lgt activity affect susceptibility to P7_Pc or other Pectobacterium phages?

  • Are any phage receptors in P. carotovorum lipoproteins that require lgt processing?

  • Could targeted modification of lgt activity be used to enhance phage biocontrol strategies?

These investigations could provide valuable insights into both fundamental host-phage interactions and applied biocontrol approaches.

How does environmental stress impact lgt expression and activity in Pectobacterium carotovorum during plant infection?

Understanding how environmental conditions affect lgt expression and activity during the infection process represents an advanced research direction with significant implications. P. carotovorum encounters various stresses during plant colonization, including pH changes, osmotic stress, plant defense compounds, and competition with other microorganisms .

Research approaches to address this question could include:

  • Transcriptional analysis: Using qRT-PCR or RNA-seq to monitor lgt expression levels under various stress conditions relevant to plant infection.

  • Promoter activity studies: Developing reporter constructs to visualize lgt expression patterns in planta under different conditions.

  • Proteomics approach: Identifying changes in the lipoprotein profile of P. carotovorum when exposed to plant extracts or specific stress conditions .

  • Mutation sensitivity testing: Comparing the sensitivity of wild-type and lgt-modified strains to various stress conditions.

  • Metabolic labeling: Using radioisotope or click-chemistry approaches to measure changes in lipoprotein processing rates under different environmental conditions.

This research direction could reveal how P. carotovorum adapts lipoprotein processing during the infection process and potentially identify conditions that modulate virulence.

What are the common technical challenges in working with recombinant Pectobacterium carotovorum lgt and how can they be addressed?

Researchers working with recombinant P. carotovorum lgt may encounter several technical challenges inherent to membrane proteins:

  • Protein solubility issues:

    • Challenge: As a membrane protein, lgt may have limited solubility in aqueous buffers.

    • Solution: Optimize detergent selection and concentration; consider using mild detergents like DDM or CHAPS that maintain protein structure while solubilizing membrane proteins.

  • Protein stability concerns:

    • Challenge: Maintaining enzymatic activity during purification and storage.

    • Solution: Store in 50% glycerol as recommended; avoid repeated freeze-thaw cycles; maintain working aliquots at 4°C for up to one week .

  • Expression yield limitations:

    • Challenge: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Consider specialized expression strains like C41(DE3) or C43(DE3); optimize induction conditions (temperature, inducer concentration, time).

  • Functional assay development:

    • Challenge: Developing assays that accurately measure enzymatic activity.

    • Solution: Adapt radioisotope labeling approaches from similar systems ; develop in vitro assays with defined substrates.

  • Protein aggregation:

    • Challenge: Tendency of purified membrane proteins to aggregate.

    • Solution: Include stabilizing agents in purification buffers; consider protein engineering approaches to enhance stability.

How can researchers troubleshoot inconsistent results in lgt functional studies?

When encountering inconsistent results in functional studies of P. carotovorum lgt, researchers should consider the following troubleshooting approaches:

  • Protein quality assessment:

    • Verify protein integrity with SDS-PAGE and western blotting

    • Confirm proper folding using circular dichroism spectroscopy

    • Assess aggregation state with size-exclusion chromatography

  • Experimental controls:

    • Include positive controls with known lgt activity

    • Implement negative controls with heat-inactivated enzyme

    • Use complemented mutant strains alongside knockout strains to confirm phenotype specificity

  • Technical variability reduction:

    • Standardize growth conditions precisely

    • Ensure consistent protein extraction methods

    • Calibrate instruments regularly

    • Prepare fresh reagents for critical experiments

  • Environmental variables:

    • Control temperature, pH, and ionic strength rigorously

    • Document lot numbers of media components and reagents

    • Consider circadian or growth phase effects on bacterial physiology

  • Data analysis approaches:

    • Implement appropriate statistical methods

    • Use biological replicates (different bacterial cultures) rather than just technical replicates

    • Consider applying more sophisticated data normalization methods

What are the best practices for designing experiments to study the role of lgt in Pectobacterium carotovorum virulence?

To effectively investigate the role of lgt in P. carotovorum virulence, researchers should implement these best practices:

  • Genetic manipulation strategy:

    • Generate clean deletion mutants using allelic exchange

    • Create conditional mutants if complete deletion is lethal

    • Develop complementation constructs with controlled expression levels

    • Consider point mutations in catalytic residues to separate protein presence from function

  • Infection model selection:

    • Use carrot tissue as a primary model system given its relevance to P. carotovorum ecology

    • Develop standardized infection protocols with quantifiable outcomes

    • Consider multiple plant hosts to assess host-specific effects

    • Implement both detached tissue and whole plant assays

  • Multi-parameter virulence assessment:

    • Measure maceration area/weight loss in plant tissue

    • Quantify bacterial population dynamics during infection

    • Assess enzyme production (pectinases, cellulases)

    • Monitor gene expression changes during infection progression

  • Environmental variable consideration:

    • Test virulence under different temperature and humidity conditions

    • Assess the impact of plant defense compound exposure

    • Evaluate performance in competition with other microorganisms

  • Temporal dynamics analysis:

    • Sample at multiple time points during infection

    • Use time-series experimental designs

    • Consider employing live imaging techniques when possible

  • Molecular mechanism dissection:

    • Identify lipoproteins affected by lgt mutation

    • Characterize specific virulence-related lipoproteins

    • Employ epistasis analysis with other virulence regulators

How might identifying the complete lipoprotein repertoire processed by lgt advance our understanding of Pectobacterium carotovorum biology?

Comprehensive identification of all lipoproteins processed by lgt in P. carotovorum would significantly enhance our understanding of this pathogen's biology in several ways:

  • Virulence mechanism elucidation: By identifying which virulence-related proteins require lgt processing, researchers could pinpoint critical components of the pathogenicity machinery . This could reveal potential targets for disease control strategies.

  • Regulatory network mapping: Lipoproteins often function in sensing and signaling pathways. A complete inventory would allow researchers to map these networks and understand how P. carotovorum perceives and responds to its environment during infection.

  • Evolutionary insights: Comparative analysis of the lipoprotein repertoire across Pectobacterium species and strains could reveal evolutionary adaptations to different plant hosts and environmental niches.

  • Functional redundancy assessment: Determining whether functional redundancy exists among lipoproteins would clarify which components are essential versus accessory for pathogenicity.

  • Biocontrol target identification: Unique lipoproteins could serve as targets for phage biocontrol strategies , as they may function as receptors for phage attachment or be involved in resistance mechanisms.

Methodological approaches for this research direction should combine proteomics, genomics, and targeted mutagenesis to identify and characterize the complete lipoprotein set requiring lgt processing.

What potential exists for developing targeted antimicrobial strategies based on lgt inhibition?

The essential nature of lgt in bacterial systems suggests it could be a promising target for developing new control strategies against P. carotovorum. Several research avenues worth exploring include:

  • Small molecule inhibitor development: Identifying compounds that specifically inhibit lgt activity could lead to novel bactericides with reduced environmental impact compared to traditional antibiotics. High-throughput screening approaches could be employed to identify candidate molecules.

  • Peptide-based inhibitors: Designing peptides that mimic lgt substrates but cannot be processed could competitively inhibit the enzyme and disrupt bacterial membrane function.

  • Combined phage-inhibitor approaches: Pairing lgt inhibitors with phage biocontrol agents like P7_Pc could create synergistic effects, potentially reducing the development of resistance to either approach alone.

  • Host plant resistance engineering: Knowledge of lgt-processed lipoproteins involved in plant-pathogen interactions could inform strategies to engineer plant resistance by disrupting these specific interactions.

  • Delivery system development: Creating targeted delivery systems for lgt inhibitors that specifically activate in the presence of P. carotovorum could maximize efficacy while minimizing environmental impact.

This research direction would need to carefully address specificity concerns to ensure inhibitors target pathogenic bacteria without disrupting beneficial microbiota.

How might systems biology approaches enhance our understanding of lgt's role in the Pectobacterium carotovorum interactome?

Systems biology approaches offer powerful tools to understand lgt's position within the broader molecular network of P. carotovorum. Integrative research strategies could include:

  • Multi-omics integration: Combining proteomics, transcriptomics, and metabolomics data from wild-type and lgt-modified strains under various conditions would provide a comprehensive view of how lgt activity influences multiple cellular systems.

  • Protein-protein interaction mapping: Using techniques like bacterial two-hybrid systems or co-immunoprecipitation followed by mass spectrometry to identify proteins that interact with lgt and lgt-processed lipoproteins.

  • Network modeling: Developing computational models of lipoprotein processing and function to predict system-level effects of perturbations to lgt activity.

  • Comparative systems analysis: Extending systems approaches across multiple Pectobacterium species and strains to identify conserved versus variable network properties.

  • Host-pathogen interaction modeling: Integrating bacterial and plant datasets to model how lgt-dependent processes influence the outcome of plant infection.

These approaches could reveal unexpected connections between lipoprotein processing and other cellular functions, potentially identifying novel intervention points for disease control.

Table 1: Key Properties of Pectobacterium carotovorum subsp. carotovorum Prolipoprotein diacylglyceryl transferase (lgt)

PropertyInformationReference
UniProt AccessionC6DAE8
Locus NamePC1_0906
Protein Length289 amino acids
Molecular FunctionCatalyzes transfer of diacylglyceryl group to prolipoproteins
Cellular LocationMembrane-associated
G+C ContentSimilar to P. carotovorum genome (50.34%)
Storage Recommendation-20°C in Tris-based buffer with 50% glycerol
Working Condition4°C for up to one week

Table 2: Comparative Analysis of Lgt Function Across Bacterial Species

Bacterial SpeciesKey Features of LgtUnique AspectsReference
Pectobacterium carotovorumMembrane protein, 289 amino acidsPlant pathogen context
Listeria monocytogenesExclusively responsible for prolipoprotein lipidationAnimal pathogen context
Other Pectobacterium speciesLimited characterization availablePotential host-specific adaptations

Table 3: Methodological Approaches for Studying Lgt in Pectobacterium carotovorum

Research ObjectiveRecommended MethodsKey ConsiderationsReference
Expression and PurificationBacterial expression systems; affinity chromatographyMembrane protein solubility; detergent selection
Activity DetectionRadioisotope labeling; immunoblottingSpecific activity assays; antibody specificity
Knockout StudiesAllelic exchange; complementationPotential essentiality; polar effects
Virulence AssessmentPlant infection models; enzyme activity assaysMultiple host testing; standardized conditions
Interactome AnalysisCo-immunoprecipitation; bacterial two-hybridSystems-level data integration

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.