Recombinant Pectobacterium carotovorum subsp. carotovorum Protein mopB (mopB)

What is mopB protein in Pectobacterium carotovorum?

MopB (Major Outer Membrane Protein B) is an essential component of the bacterial outer membrane in Pectobacterium carotovorum subsp. carotovorum. Based on homology with related proteins in other species, mopB likely contains a β-barrel structure with an OmpA-like domain and a predicted calcium-binding motif . The full-length protein consists of 140 amino acids with the sequence: MAIASISSPAPVASQQSTLVTEPPLTSSMLLTQVGSVLAGILLFILLIAWLARKLGFAPQAKQNKLLKVVSSCPVGQRERVVIVEVDNTWLVLGVTAQQITPLHTLPAQPTNDSSSTGDTKPVDFNQLLKKVLKRPEKSE . Evidence from studies on homologous proteins in related bacterial species suggests mopB plays critical roles in membrane integrity, bacterial adhesion, and pathogenicity.

What expression systems are available for producing recombinant Pectobacterium carotovorum mopB?

Multiple expression systems have been developed for the production of recombinant Pectobacterium carotovorum proteins, including mopB. These systems include:

E. coli remains the predominant expression system for recombinant mopB production, with available products featuring N-terminal His tags for purification purposes . The bacterial system produces correctly folded protein with sufficient yield for most research applications. For specialized applications requiring post-translational modifications, alternative eukaryotic expression systems may be considered.

What analytical methods are used to characterize recombinant mopB?

Standard analytical methods for characterizing recombinant mopB include:

• SDS-PAGE for purity assessment (>90% purity typically achievable)

• Western blotting for identity confirmation

• Mass spectrometry for accurate molecular weight determination

• Circular dichroism for secondary structure analysis

• Size exclusion chromatography for oligomeric state determination

Researchers typically validate protein identity through comparison with predicted molecular weights and immunoreactivity with anti-His antibodies when tagged variants are used. Functional assays measuring membrane integration capabilities can provide additional validation of proper protein folding.

What functional mechanisms underlie mopB's contribution to Pectobacterium virulence?

Based on studies of homologous proteins in related bacterial species, mopB likely contributes to Pectobacterium virulence through multiple mechanisms. In Xylella fastidiosa, MopB deletion impairs cell-to-cell aggregation, surface attachment, and biofilm formation . More significantly, mopB deletion in X. fastidiosa completely abolishes twitching motility and eliminates type IV and type I pili formation, potentially by destabilizing the outer membrane .

Electron microscopy of bacterial cell surfaces from mopB deletion mutants reveals significant structural abnormalities, suggesting the protein plays a crucial role in maintaining outer membrane integrity. This membrane destabilization likely affects numerous virulence-associated structures and functions. MopB-deficient mutants show significantly reduced virulence in plant infection models, with delayed symptom development and reduced disease severity .

The predicted calcium-binding motif (EF-hand) in the C-terminus of MopB may mediate calcium-dependent activities that contribute to virulence. Previous research has demonstrated that calcium increases surface attachment, biofilm formation, and twitching motility in some bacterial pathogens, suggesting a potential regulatory mechanism for MopB function .

How does mopB expression change during host plant infection?

Transcriptome analyses of Pectobacterium carotovorum during plant infection reveal complex gene expression dynamics. RNA-Seq analyses comparing transcriptome profiles from cellular infection with growth in minimal and rich media show that differentially expressed genes (log 2-fold ratio ≥ 1.0) in Pectobacterium carotovorum subsp. carotovorum recovered at various time points after host inoculation cover approximately 50% of genes in the genome .

While specific mopB expression patterns were not detailed in the available search results, outer membrane proteins like mopB often show regulated expression during the infection process. The dynamic expression changes observed during infection suggest that many bacterial proteins, potentially including mopB, are regulated in response to host conditions. Significantly differentially expressed genes (log 2-fold ratio ≥ 2.0) have been classified into five expression pattern types during infection .

The experimental approach for studying such expression dynamics typically involves:

• Recovery of bacterial cells from infected plant tissue at specific time points

• RNA extraction and high-throughput sequencing

• Comparison with in vitro controls grown in minimal and rich media

• Validation of expression patterns using RT-qPCR

What is the relationship between mopB and bacterial membrane integrity?

MopB proteins function as critical structural components of bacterial outer membranes. The β-barrel structure characteristic of these proteins facilitates integration into the bacterial outer membrane, contributing to membrane stability and integrity. Deletion of mopB genes in bacterial pathogens typically results in significant membrane abnormalities.

In Xylella fastidiosa, mopB deletion disrupts membrane structure to such an extent that it eliminates the formation of type IV and type I pili, suggesting the protein provides essential structural support for the assembly of these membrane-associated virulence factors . The membrane destabilization observed in mopB mutants has pleiotropic effects, influencing multiple cellular processes including:

• Cell-cell aggregation

• Surface attachment

• Biofilm formation

• Twitching motility

• Pili biogenesis

These findings suggest that beyond its structural role, mopB may serve as an organizational center for the assembly of membrane-associated virulence factors. The substantial impact of mopB deletion on cellular phenotypes has made it a potential target for antimicrobial development.

What are the optimal conditions for storage and handling of recombinant mopB?

Recombinant mopB requires specific storage and handling conditions to maintain structural integrity and functionality. Based on supplier recommendations, the following protocols should be implemented:

• Storage conditions: Store at -20°C/-80°C upon receipt with aliquoting necessary for multiple use

• Reconstitution protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

• Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

• Stability considerations: Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week

For experimental applications, freshly thawed protein typically provides optimal results. Researchers should validate protein integrity via SDS-PAGE before use in critical experiments, particularly after extended storage periods.

What experimental approaches are effective for studying mopB function in Pectobacterium?

Several experimental approaches have proven effective for investigating mopB function in bacterial pathogens:

• Mutational analysis:

  • Gene deletion strategies utilizing natural competence (when available)

  • Site-directed mutagenesis of specific functional domains

  • Complementation studies to confirm phenotype restoration

• Microscopy techniques:

  • Electron microscopy for visualizing cell surface and membrane structures

  • Immunofluorescence microscopy for protein localization

  • Live-cell imaging to study dynamic processes

• Virulence assays:

  • Plant infection models to assess pathogenicity

  • Quantitative PCR for bacterial population assessment in plant tissues

  • Disease severity scoring systems for symptom evaluation

• Biochemical approaches:

  • Protein-protein interaction studies

  • Calcium binding assays for EF-hand domain functionality

  • Membrane integrity assessments

When studying mopB mutants in Pectobacterium, researchers should consider both in vitro phenotypes (biofilm formation, surface attachment) and in planta behaviors (colonization, symptom development). In Xylella fastidiosa research, tobacco (Nicotiana tabacum) has been used successfully as a host for greenhouse conditions when assessing the impact of mopB mutations on virulence .

How can researchers effectively analyze calcium-binding properties of mopB?

The predicted calcium-binding motif (EF-hand) in the C-terminus of MopB warrants specific experimental approaches:

• Isothermal titration calorimetry (ITC):

  • Provides direct measurement of binding affinities

  • Determines stoichiometry and thermodynamic parameters

  • Requires purified protein in calcium-free buffer

• Fluorescence spectroscopy:

  • Intrinsic tryptophan fluorescence changes upon calcium binding

  • Can be enhanced with engineered fluorescent probes

  • Allows for determination of binding kinetics

• Circular dichroism spectroscopy:

  • Detects calcium-induced conformational changes

  • Particularly useful for EF-hand domains

  • Provides information about secondary structure alterations

• Functional assays:

  • Comparing wild-type and EF-hand mutant proteins

  • Assessing calcium-dependent biological activities

  • Testing function in varying calcium concentrations

When studying calcium binding to MopB, researchers should consider the physiological calcium concentrations found in plant xylem sap (approximately 2.75 mM in tobacco) . This environmental context may be crucial for understanding the functional significance of calcium binding to MopB during infection.

How does mopB from Pectobacterium compare to homologs in other plant pathogens?

MopB homologs exist across multiple bacterial plant pathogens, with some functional conservation but also species-specific adaptations:

Homologs of mopB in the plant pathogen Xanthomonas campestris pv. campestris and in the opportunistic pathogen Stenotrophomonas maltophilia are required for pathogenesis . The roles of these proteins appear conserved across species, with common functions in membrane integrity and virulence.

In Xylella fastidiosa, deletion of mopB slowed disease development and reduced disease severity in tobacco plants, yet had no effect on bacterial population in leaf petioles, demonstrating that the mutants could still colonize plants . This suggests that the virulence contribution of MopB may be related more to symptom development than to colonization capability.

How can transcriptomic approaches enhance our understanding of mopB function?

Transcriptomic analyses provide valuable insights into the regulatory networks governing mopB expression and function:

• Infection time-course analyses:

  • RNA-Seq during infection reveals temporal expression patterns

  • Comparison with in vitro controls identifies infection-specific regulation

  • Classification of expression patterns (as demonstrated for Pectobacterium)

• Differential expression analysis:

  • Comparing wild-type and mopB mutant transcriptomes

  • Identifying compensatory responses to membrane destabilization

  • Discovering co-regulated genes that may function with mopB

• Host-pathogen interaction studies:

  • Simultaneous analysis of plant and bacterial transcriptomes

  • Correlation of bacterial gene expression with host defense responses

  • Identification of host factors influencing mopB expression

• Environmental response profiling:

  • Expression changes under different calcium concentrations

  • Response to other environmental stresses

  • Adaptation to different plant hosts

Transcriptomic approaches have already revealed that approximately 50% of genes in the Pectobacterium carotovorum genome show differential expression during infection . Such comprehensive analyses can place mopB within its broader regulatory context and identify previously unknown functional associations.

What emerging technologies could advance mopB functional studies?

Several cutting-edge technologies offer promising approaches for deeper understanding of mopB function:

• CRISPR-Cas gene editing:

  • Precise modification of mopB domains

  • Creation of conditional mutants

  • Simultaneous targeting of multiple genes

• Cryo-electron microscopy:

  • High-resolution structural analysis of membrane-integrated mopB

  • Visualization of interaction partners

  • Conformational changes upon calcium binding

• Single-cell technologies:

  • mopB expression heterogeneity in bacterial populations

  • Correlation with single-cell phenotypes

  • In situ expression during infection

• Synthetic biology approaches:

  • Engineering chimeric mopB proteins with domains from different species

  • Creating tunable expression systems

  • Developing biosensors based on mopB-dependent functions

These advanced methodologies could resolve current knowledge gaps regarding the exact mechanistic role of mopB in Pectobacterium carotovorum virulence and potentially identify novel approaches for controlling bacterial soft rot diseases.

What are the implications of mopB research for controlling bacterial plant diseases?

Understanding mopB function has significant implications for developing novel control strategies:

• Targeted antimicrobials:

  • Small molecules disrupting mopB function

  • Peptides blocking critical mopB interactions

  • Calcium chelators affecting mopB-dependent processes

• Resistant crop development:

  • Plants expressing mopB-binding antimicrobial peptides

  • Host modifications that alter calcium availability

  • Engineering of plant barriers resistant to mopB-dependent penetration

• Biocontrol approaches:

  • Competitive bacteria expressing modified mopB proteins

  • Bacteriophages targeting mopB-dependent structures

  • Probiotic microbes that interfere with mopB function

• Diagnostic applications:

  • mopB-based detection methods

  • Strain typing based on mopB sequence variants

  • Monitoring tools for field application

Given the critical role of mopB in bacterial pathogenicity, targeting this protein or its functional networks represents a promising avenue for developing sustainable control strategies against economically important plant diseases caused by Pectobacterium species.