Recombinant Pectobacterium carotovorum subsp. carotovorum Sensor histidine kinase pmrB (pmrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pmrB; W5S_4174; Sensor histidine kinase PmrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Pectobacterium sp. (strain SCC3193)
Target Names
pmrB
Target Protein Sequence
MKGDSEAVTSMRRRLVLALGGILLVCQMISVFWLWHESEEQIGLLVDKSLSAAAQNMQID QEINEAIASLSIPSLVMVILTLLMCFQAVSWITRPLSRLQEELQDRTAENLEPLPQQSDI KEIAAVTHTINQLFQRLDETLKRDRQFTADVAHELRTPLAGIRLHLELHQQQHQIDCSSL IKRIDKMVKTVEQLLLLARVGQEFSAGHHENVAFLKDVIFPMQDELAEMLQKRQQRLKWV LPQEDVTLHGDATLLQLLLRNLVENAYRYSPETSQITVSLNTQQHVELQIEDEGQGIDES KVGELSKAFVRMDSRYGGIGLGLSIVTRIAQLHNGKFFLSNRPQGPGALARVVLTTPDNY PDAA
Uniprot No.

Target Background

Function
Recombinant Pectobacterium carotovorum subsp. carotovorum Sensor histidine kinase pmrB (pmrB) is a member of the two-component regulatory system PmrB/PmrA, involved in virulence regulation. It functions as a sensor protein kinase, autophosphorylating at a histidine residue and subsequently transferring the phosphate group to PmrA in response to changes in external pH and iron levels.
Database Links

KEGG: pec:W5S_4174

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of pmrB in Pectobacterium carotovorum?

PmrB in Pectobacterium carotovorum functions as a sensor histidine kinase within a two-component signal transduction system. It serves primarily as an iron (Fe) sensor, playing a crucial role in bacterial response to environmental iron levels . This protein belongs to the broader family of BasS/PmrB sensor proteins found across multiple bacterial species. When activated by appropriate stimuli, pmrB undergoes autophosphorylation at a conserved histidine residue, subsequently transferring this phosphoryl group to its cognate response regulator, which then mediates changes in gene expression to adapt to environmental conditions.

How does the pmrB signaling pathway function in P. carotovorum?

The pmrB signaling pathway in P. carotovorum operates through a classic two-component signal transduction mechanism. When environmental iron levels change, the extracellular or periplasmic sensing domain of pmrB detects this alteration and triggers conformational changes in the protein. This leads to autophosphorylation of a conserved histidine residue in the kinase domain. The phosphoryl group is then transferred to an aspartate residue in the cognate response regulator (likely PmrA), activating it to bind DNA and regulate the expression of target genes . This pathway allows the bacterium to respond to changing iron conditions by modifying cellular processes such as iron uptake, storage, and utilization.

What are the structural characteristics of pmrB that enable its sensing function?

The pmrB protein in P. carotovorum contains several characteristic domains common to sensor histidine kinases. These typically include:

  • An N-terminal periplasmic sensing domain that detects environmental signals

  • Transmembrane helices that anchor the protein in the membrane

  • A HAMP domain (present in Histidine kinases, Adenylyl cyclases, Methyl-accepting proteins, and Phosphatases) that transmits signals across the membrane

  • A histidine phosphotransfer (DHp) domain containing the conserved histidine residue

  • A C-terminal catalytic domain (CA) with kinase activity

The transmembrane helices play a critical role in signal transduction across the membrane . As observed in other sensor histidine kinases, signal recognition by the extracellular domain likely causes subtle alterations in the positions of these helices, transmitting the signal to the cytoplasmic domains and triggering autophosphorylation.

How does pmrB in P. carotovorum differ from homologous proteins in other bacterial species?

A comparative alignment of pmrB sequences shows higher conservation in the cytoplasmic kinase domains than in the periplasmic sensing domains, suggesting that while the signaling mechanism remains conserved, the specific environmental cues recognized may vary. When compared to pmrB homologs in more distantly related bacteria such as Escherichia or Klebsiella species, the P. carotovorum pmrB shows more significant divergence, particularly in regions involved in specificity of response regulator interaction .

What is the mechanism of pmrB autophosphorylation in P. carotovorum and how does it compare to other histidine kinases?

The autophosphorylation mechanism of pmrB in P. carotovorum likely follows one of two established models for histidine kinases: cis-autophosphorylation (where one subunit phosphorylates itself) or trans-autophosphorylation (where one subunit phosphorylates the other) . Current research has not definitively established which mechanism operates in P. carotovorum pmrB, presenting an opportunity for further investigation.

The autophosphorylation reaction involves ATP binding to the catalytic domain, followed by transfer of the γ-phosphoryl group to the conserved histidine residue in the DHp domain. The specific residues involved in ATP binding and phosphotransfer are highly conserved across histidine kinases, though the orientation of the catalytic domain relative to the DHp domain can differ between cis- and trans-phosphorylating kinases.

To determine the specific mechanism in P. carotovorum pmrB, researchers would need to:

  • Create heterodimers with one subunit containing a mutation in the catalytic site and the other with a mutation in the phosphorylation site

  • Analyze the phosphorylation patterns to distinguish between cis- and trans-mechanisms

  • Perform structural studies to visualize the orientation of domains during autophosphorylation

How do environmental factors beyond iron influence pmrB activity in P. carotovorum during plant infection?

While pmrB is primarily characterized as an iron sensor, its activity in P. carotovorum during plant infection is likely influenced by multiple environmental factors. During infection, P. carotovorum encounters varying microenvironments with different pH levels, antimicrobial compounds, and nutrient availability. These factors potentially modulate pmrB activity through:

  • Direct interaction with the sensing domain

  • Allosteric effects on protein conformation

  • Post-translational modifications affecting kinase activity

  • Crosstalk with other signaling pathways

Research examining pmrB activity under different conditions that mimic plant environments would help elucidate these influences. Experimental approaches should include:

  • Measuring pmrB phosphorylation levels in response to various plant extracts

  • Assessing gene expression changes in pmrB-regulated pathways under different infection conditions

  • Analyzing the virulence of pmrB mutants in various plant hosts

  • Identifying potential small molecule modulators of pmrB activity from plant sources

What are the optimal approaches for cloning and expressing recombinant P. carotovorum pmrB?

The successful cloning and expression of recombinant pmrB from P. carotovorum requires careful consideration of several factors, given its nature as a membrane-associated protein. Based on established protocols for similar proteins, the following methodological approach is recommended:

Cloning Strategy:

  • Amplify the pmrB gene from P. carotovorum genomic DNA using high-fidelity polymerase

  • Consider expressing either the full-length protein or specific domains (cytoplasmic portions express better than full transmembrane proteins)

  • Use vectors that provide appropriate fusion tags (His6, MBP, or GST) to aid in purification

  • For membrane protein expression, vectors with inducible promoters allowing tight regulation are preferable

Expression Systems:

Expression SystemAdvantagesLimitationsRecommended Use
E. coli BL21(DE3)High yield, easy handlingMay not fold complex proteins properlyCytoplasmic domains
E. coli C41/C43Optimized for membrane proteinsLower yieldsFull-length pmrB
Cell-free systemsAvoids toxicity issuesExpensive, lower scaleInitial screening

Expression Conditions:

  • Induce at lower temperatures (16-20°C) to promote proper folding

  • Use lower inducer concentrations to prevent inclusion body formation

  • Add specific membrane mimetics (detergents, nanodiscs) for full-length protein

  • Supplement with additional factors if needed (chaperones, rare tRNAs)

For purification, a two-step approach combining affinity chromatography with size exclusion chromatography typically yields the purest protein preparations suitable for subsequent functional and structural studies .

What methods are most effective for analyzing pmrB phosphorylation and kinase activity?

Analysis of pmrB phosphorylation and kinase activity requires sensitive and specific biochemical assays. The following methodologies are particularly effective:

In vitro Autophosphorylation Assays:

  • Incubate purified pmrB with [γ-32P]ATP or [γ-33P]ATP

  • Stop the reaction at various time points using SDS-sample buffer or acid quenching

  • Separate products using SDS-PAGE and visualize by autoradiography

  • Alternatively, use Phos-tag SDS-PAGE to separate phosphorylated from non-phosphorylated protein without radioactivity

Phosphotransfer Assays:

  • First autophosphorylate pmrB as described above

  • Add purified cognate response regulator

  • Monitor phosphotransfer kinetics by stopping the reaction at different time points

  • Analyze the decrease in pmrB phosphorylation and increase in response regulator phosphorylation

Mass Spectrometry Approaches:

  • Perform in vitro phosphorylation using non-radioactive ATP

  • Digest the protein with specific proteases

  • Analyze by LC-MS/MS to identify phosphorylated peptides

  • Use neutral loss scanning to detect characteristic losses of phosphate groups

For kinetic analyses, researchers should ensure time points are appropriately spaced to capture both rapid initial phosphorylation and slower steady-state phases. Additionally, varying ATP concentrations allows determination of Km and Vmax values, providing insights into the catalytic efficiency of pmrB .

How can researchers generate and validate pmrB mutants to study structure-function relationships?

Generating and validating pmrB mutants is crucial for understanding structure-function relationships. The following systematic approach is recommended:

Mutant Design Strategy:

  • Use sequence alignments and structural predictions to identify conserved residues

  • Focus on key functional domains: sensing domain, transmembrane helices, HAMP domain, DHp domain (containing the phosphorylated histidine), and catalytic domain

  • Design mutations to test specific hypotheses:

    • Phosphorylation site mutations (e.g., His→Ala) to abolish kinase activity

    • ATP-binding site mutations to affect catalysis

    • Transmembrane helix mutations to disrupt signal transduction

    • Sensor domain mutations to alter ligand recognition

Generation Methods:

  • Site-directed mutagenesis of cloned pmrB using overlap extension PCR

  • Gibson Assembly for larger modifications or domain swaps

  • For chromosomal mutations, use allelic exchange vectors or CRISPR-Cas9 systems

Validation Approaches:

  • Sequence verification of all constructed mutants

  • Expression analysis by Western blotting to confirm stability

  • Subcellular localization studies to ensure proper membrane integration

  • Functional assays including:

    • In vitro autophosphorylation assays

    • Phosphotransfer to cognate response regulator

    • In vivo reporter assays measuring target gene expression

Transmembrane helix mutants require particular attention, as mutagenesis studies coupled with computational modeling can reveal crucial interactions. The REX MD (Replica Exchange Molecular Dynamics) computational approach has proven effective for modeling transmembrane helix interactions in histidine kinases , providing valuable guidance for mutagenesis experiments.

How should researchers analyze and interpret contradictory results in pmrB phosphorylation studies?

Contradictory results in pmrB phosphorylation studies can arise from multiple experimental variables. A systematic troubleshooting approach should include:

Common Sources of Contradictions:

  • Protein preparation differences (full-length vs. truncated constructs)

  • Experimental conditions (buffer composition, pH, temperature)

  • Presence/absence of membrane mimetics for full-length proteins

  • Detection method sensitivity and specificity

  • Time-dependent changes in phosphorylation states

Resolution Strategy:

  • Standardize protein preparations by ensuring consistent:

    • Expression systems and purification protocols

    • Protein:lipid ratios when using membrane mimetics

    • Storage conditions to prevent degradation

  • Conduct parallel experiments with:

    • Multiple detection methods (radiometric, Phos-tag, MS)

    • Varied time courses to capture transient states

    • Internal controls using well-characterized histidine kinases

  • Implement quantitative analysis:

    • Use phosphorimage quantification with standard curves

    • Apply appropriate statistical tests for significance

    • Calculate phosphorylation rates under different conditions

When interpreting contradictory phosphorylation data, researchers should consider that pmrB might exhibit different behaviors depending on its oligomeric state, association with other proteins, or the presence of specific ligands that might not be present in all experimental conditions .

What computational approaches are most valuable for predicting pmrB structure and function in P. carotovorum?

Given the challenges of obtaining experimental structures for membrane proteins like pmrB, computational approaches offer valuable insights. The following methods are particularly useful:

Structural Prediction Approaches:

  • Homology modeling using related histidine kinases with known structures

  • Ab initio modeling for unique domains with no close homologs

  • Hybrid approaches combining template-based and physics-based methods

  • Special consideration for transmembrane domains using specific prediction algorithms

Molecular Dynamics Simulations:
The Replica Exchange Molecular Dynamics (REX MD) approach has proven effective for modeling transmembrane helix complexes in histidine kinases . For pmrB, this would involve:

  • Building initial models of the transmembrane helices

  • Embedding them in a lipid bilayer model

  • Running REX MD simulations to sample conformational space

  • Analyzing the resulting ensemble for stable configurations

Sequence-Based Functional Predictions:

  • Multiple sequence alignments to identify conserved motifs

  • Co-evolution analysis to predict interacting residues

  • Genomic context analysis to identify functionally related genes

Validation of Computational Models:
All computational predictions should be validated experimentally through:

  • Site-directed mutagenesis of predicted functional residues

  • Domain swapping experiments to test predicted domain functions

  • Cross-linking studies to validate predicted protein-protein interactions

A combined approach using both REX MD simulations and mutagenesis studies, similar to that employed for the YycG histidine kinase , would provide the most robust predictions for pmrB structure and function.

How can researchers effectively differentiate between the kinase and phosphatase activities of pmrB?

Sensor histidine kinases like pmrB often exhibit both kinase (phosphorylation) and phosphatase (dephosphorylation) activities toward their cognate response regulators. Differentiating between these activities requires careful experimental design:

Kinase-Specific Assays:

  • Incubate purified pmrB with ATP and measure autophosphorylation

  • Add cognate response regulator and monitor phosphotransfer

  • Use ATP analogs that support phosphorylation but resist hydrolysis

Phosphatase-Specific Assays:

  • Pre-phosphorylate the response regulator using:

    • Small molecule phosphodonors like acetyl phosphate

    • A different histidine kinase known to phosphorylate the same response regulator

  • Add purified pmrB in the absence of ATP

  • Monitor dephosphorylation of the response regulator over time

Mutation-Based Approaches:
Specific mutations can differentially affect kinase and phosphatase activities:

  • Mutations in the ATP-binding domain typically affect kinase activity while preserving phosphatase activity

  • Mutations in the DHp domain may affect both activities or selectively impact one

In Vivo Reporter Systems:
Develop genetic systems where:

  • Reporter gene expression correlates with response regulator phosphorylation

  • Monitor reporter activity under conditions that favor either kinase or phosphatase activity

The phosphatase activity of sensor kinases can be physiologically significant despite typically requiring higher concentrations of the kinase relative to the response regulator in vitro . When designing experiments, researchers should consider that the ratio of kinase to response regulator is often tightly controlled in vivo, which may affect the relative importance of these activities in different contexts.

What are the promising approaches for targeting pmrB in P. carotovorum for bacterial control?

Given that histidine kinases like pmrB are being explored as novel antibacterial drug targets , several approaches show promise for controlling P. carotovorum:

Small Molecule Inhibitor Development:

  • High-throughput screening of chemical libraries against purified pmrB

  • Structure-based design of ATP-competitive inhibitors

  • Allosteric modulators that lock the protein in an inactive conformation

  • Compounds that disrupt critical protein-protein interactions

Peptide-Based Approaches:

  • Design peptides that mimic interaction interfaces

  • Cell-penetrating peptides targeting intracellular domains

  • Cyclic peptides with enhanced stability for environmental applications

Phage-Based Strategies:
Given that P. carotovorum can be targeted by phages like vB_PcaM_P7_Pc , researchers could:

  • Engineer phages to specifically target bacteria with functional pmrB systems

  • Develop phage cocktails that target multiple virulence systems including pmrB

  • Create phage-delivered CRISPR systems to specifically disrupt pmrB

Evaluation Criteria for Control Methods:

ApproachEfficacy MetricsEnvironmental ImpactResistance Development Risk
Small moleculesIC50, MIC valuesBiodegradation, off-target effectsModerate to high
PeptidesBinding affinity, cellular uptakeTypically low impactLow to moderate
PhagesHost range, killing efficiencyMinimal impactLow with cocktail approaches

Any control strategy should be evaluated not only for efficacy against P. carotovorum but also for specificity to avoid disrupting beneficial microbiota in agricultural settings .

How might environmental iron fluctuations affect pmrB activity in the context of P. carotovorum pathogenicity?

As pmrB functions primarily as an iron sensor , understanding how environmental iron fluctuations affect its activity is crucial for comprehending P. carotovorum pathogenicity:

Research Approaches:

  • Culture P. carotovorum under various iron concentrations and measure:

    • pmrB phosphorylation status

    • Target gene expression profiles

    • Virulence factor production

    • Plant tissue maceration ability

  • Create iron-responsive biosensors by:

    • Fusing pmrB-regulated promoters to reporter genes

    • Monitoring activation in planta during infection

    • Correlating with local iron availability in plant tissues

  • Analyze pmrB mutants with altered iron sensitivity to determine:

    • How iron sensing calibration affects virulence

    • Whether iron serves as a direct signal or proxy for other host conditions

    • If iron chelation could serve as a disease management strategy

Plant hosts actively limit iron availability as a defense mechanism, while pathogens deploy various strategies to acquire iron. The pmrB system likely plays a critical role in this host-pathogen interaction, adjusting bacterial physiology to succeed under iron-limited conditions. Understanding these dynamics could reveal novel intervention points for controlling bacterial soft rot diseases caused by P. carotovorum .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.