Recombinant Pectobacterium carotovorum subsp. carotovorum Type II secretion system protein F (outF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
outF; Type II secretion system protein F; T2SS protein F; General secretion pathway protein F; Pectic enzymes secretion protein OutF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora)
Target Names
outF
Target Protein Sequence
MAQYHYQALDAQGKKCRGTQEADSARQARQLLRERGLVPLSVDENRGDQQKSGSTGLSLR RKIRLSTSDLALLTRQLATLVAASMPLEEALDAVAKQSEKPHLSQLMAAVRSKVMEGHSL ADAMKCFPGSFERLYCAMVAAGETSGHLDAVLNRLADYTEQRQQMRSRIQQAMIYPCVLT VVAIAVVSILLSVVVPKVVEQFIHMKQALPLSTRVLMGMSDAVRTFGPWMLLALLAGFMA FRVMLRQEKRRVSFHRRLLHLPLIGRIARGLNTARYARTLSILNASAVPLLQAMRISGDV MSNDYARHRLSLATDAVREGVSLHKALEQTALFPPMMRHMIASGERSGELDSMLERAADN QDREFSSQMTLALGLFEPLLVVSMAAVVLFIVLAILQPILQLNTLMSS
Uniprot No.

Target Background

Function

Component of the type II secretion system's inner membrane complex. It is essential for the energy-dependent secretion of extracellular factors, including proteases and toxins, from the periplasm.

Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of Type II secretion systems in Gram-negative bacteria?

Type II secretion (T2S) represents a specialized mechanism by which Gram-negative pathogens, including Pectobacterium carotovorum, secrete proteins into the extracellular environment and/or host organisms. This system is predominantly found within the Proteobacteria phylum, occurring in numerous genera within the Alpha-, Beta-, Gamma-, and Deltaproteobacteria classes . The T2SS plays crucial roles in bacterial pathogenesis by facilitating the secretion of toxins, degradative enzymes, and other virulence factors that enable host colonization, tissue degradation, and immune suppression .

How is the Type II secretion system organized structurally?

The T2SS represents a sophisticated multi-protein complex with distinct architectural components. The system consists of four major subassemblies: (1) an inner membrane platform containing multiple copies of at least four core membrane proteins, (2) a periplasmic filamentous pseudopilus composed of pseudopilin proteins, (3) a dodecameric outer membrane complex primarily formed by secretin protein, and (4) a cytoplasmic secretion ATPase that provides energy for the system . The inner membrane platform, which includes the outF protein, serves as the nexus of the system by communicating with all other elements to orchestrate the secretion process .

What is the general mechanism of protein secretion through the T2SS?

The T2SS employs a two-step secretion mechanism. Initially, exoproteins are synthesized with N-terminal signal peptides that target them for cytoplasmic membrane translocation through either the SecYEG or Tat complexes . Following removal of the signal peptides, the exoproteins transiently reside in the periplasmic compartment before outer membrane translocation . The current model suggests that exoprotein binding to periplasmic domains of T2SS components stimulates ATPase activity, which drives the assembly and extension of the pseudopilus. This growing pseudopilus then functions as a piston that pushes exoproteins through the secretin channel in the outer membrane .

What is the specific role of outF within the T2SS architecture?

The outF protein (also annotated as GspF in some bacterial species) is a critical component of the inner membrane platform of the T2SS. As part of this platform, outF helps mediate interactions between the cytoplasmic ATPase, the pseudopilus, and potentially the outer membrane complex . The inner membrane platform, through these interactions, converts conformational changes in the ATPase due to ATP hydrolysis into an extension of the pseudopilus. This mechanical coupling is essential for the functional secretion of exoproteins through the outer membrane channel .

What structural features characterize the outF protein?

While the search results don't provide specific structural details for outF, information about T2SS components suggests that outF likely contains transmembrane domains that anchor it in the inner membrane, with portions extending into both the cytoplasm and periplasm. These domains facilitate interactions with other T2SS components, including the ATPase on the cytoplasmic side and potentially pseudopilus components on the periplasmic side . The protein's molecular architecture would be optimized to transmit conformational changes throughout the secretion system.

How does outF contribute to P. carotovorum pathogenicity?

In P. carotovorum, the outF protein facilitates the secretion of various degradative enzymes, particularly pectinases and cellulases that break down plant cell walls, leading to tissue maceration and the characteristic soft rot symptoms . The T2SS in P. carotovorum represents a critical virulence mechanism that enables the bacterium to access nutrients from plant tissues and proliferate within the host. Additionally, the T2SS may secrete factors that contribute to blackleg disease in potatoes, another significant disease caused by certain strains of P. carotovorum .

How can recombinant outF protein be produced for laboratory studies?

Recombinant Pectobacterium carotovorum subsp. carotovorum Type II secretion system protein F (outF) can be produced using several expression systems, including E. coli, yeast, baculovirus, or mammalian cells . The most common approach involves cloning the outF gene into a suitable expression vector, transforming the construct into an expression host (most commonly E. coli), inducing protein expression, and purifying the recombinant protein using chromatographic techniques. Purification typically achieves ≥85% purity as determined by SDS-PAGE analysis . For structural studies, affinity tags may be incorporated to facilitate purification, though care must be taken to ensure these modifications don't interfere with protein function.

What genetic manipulation strategies are effective for studying outF function?

Several genetic approaches can be employed to study outF function:

ApproachMethodologyApplicationAnalytical Output
Gene knockoutCRISPR-Cas, homologous recombinationDetermine essentiality and phenotypic effectsAssessment of growth, morphology, secretion defects
ComplementationPlasmid-based expression in knockout strainVerify gene function and assess mutant phenotypesRestoration of wild-type phenotype
Site-directed mutagenesisPCR-based methods to introduce specific mutationsIdentify critical residues and domainsStructure-function relationships
Reporter fusionsFusion of outF with reporter genes (GFP, LacZ)Monitor expression, localizationExpression patterns, protein dynamics
Chromosomal taggingIntegration of epitope tags at native locusStudy protein in native contextProtein levels, interactions, localization

What biochemical approaches can assess outF interactions with other T2SS components?

The inner membrane platform of the T2SS, which includes outF, interacts with multiple components of the secretion machinery . To characterize these interactions, researchers can employ:

  • Co-immunoprecipitation with antibodies against outF to identify interacting partners

  • Bacterial two-hybrid or yeast two-hybrid assays to detect binary protein interactions

  • Surface plasmon resonance (SPR) to quantify binding affinities and kinetics

  • Chemical crosslinking followed by mass spectrometry to map interaction interfaces

  • Blue native PAGE to isolate and characterize native protein complexes

  • Fluorescence resonance energy transfer (FRET) to visualize protein associations in vivo

How can researchers determine if outF affects substrate specificity of the T2SS?

The T2SS can secrete various proteins, from toxins to degradative enzymes . To investigate whether outF influences substrate selection:

  • Generate chimeric outF proteins by domain swapping with homologs from other bacteria

  • Assess secretion profiles using proteomic approaches (e.g., mass spectrometry)

  • Perform binding assays between purified outF domains and known T2SS substrates

  • Create outF variants with point mutations in predicted substrate interaction regions

  • Analyze structural changes in the secretion apparatus using electron microscopy

What role does outF play in the energetics of type II secretion?

While the ATPase (GspE) provides the primary energy input for T2SS function, outF likely participates in energy transduction . Researchers can investigate this aspect by:

  • Measuring ATPase activity in the presence and absence of functional outF

  • Analyzing ATP consumption rates in strains with wild-type versus mutant outF

  • Identifying potential energy-coupling motifs in outF through sequence analysis

  • Performing structure-function studies of the outF-ATPase interface

  • Using single-molecule techniques to observe conformational changes during energy transfer

How do environmental conditions affect outF function in the T2SS?

T2SS activity may be modulated by environmental parameters that bacteria encounter during infection. To explore environmental effects on outF:

  • Assess T2SS assembly and secretion under varying pH, temperature, and osmolarity

  • Examine outF expression patterns under different growth conditions

  • Investigate post-translational modifications of outF in response to environmental signals

  • Compare secretion efficiency across conditions that mimic different host environments

  • Analyze outF stability and turnover rates under stress conditions

How conserved is outF across different bacterial species with T2SS?

Type II secretion systems are widespread among Proteobacteria . A comparative analysis reveals:

Bacterial SpeciesoutF HomologKey CharacteristicsFunctional Specialization
P. carotovorumOutFPlant pathogen T2SS componentSecretion of plant cell wall-degrading enzymes
E. coliGspFHuman pathogen T2SS componentSecretion of heat-labile enterotoxin
L. pneumophilaLspFHuman pathogen T2SS componentSecretion of effectors for intracellular survival
V. choleraeEpsFHuman pathogen T2SS componentSecretion of cholera toxin
P. aeruginosaXcpSOpportunistic pathogen T2SS componentSecretion of multiple virulence factors

These homologs share conserved domains and general architecture, suggesting evolutionary preservation of core functional elements while accommodating species-specific adaptations .

What can be learned from comparing T2SS outF with related secretion systems?

The T2SS shares evolutionary relationships with other bacterial secretion systems, particularly type IV pilus systems . Comparative analysis reveals:

  • Structural homology between T2SS pseudopilins and type IV pilins

  • Functional parallels in assembly mechanisms and energy utilization

  • Similar inner membrane platform architectures

  • Evolutionary adaptations for different secretion purposes

  • Insights into potential targeting strategies that could affect multiple secretion systems

How has horizontal gene transfer shaped outF evolution in P. carotovorum?

Genomic analyses suggest that certain virulence-associated gene clusters in P. carotovorum may have been acquired through horizontal gene transfer . Integrative and conjugative elements (ICEs) carrying these clusters have been identified in different strains of both P. atrosepticum and P. carotovorum, present in different genomic locations . This suggests that virulence-associated genes, potentially including T2SS components like outF, might have been acquired independently on multiple occasions. These horizontal transfer events could contribute to the emergence of new pathogenic variants with enhanced virulence or host range .

How can outF research contribute to developing disease control strategies?

Understanding outF function provides several avenues for potential disease control:

  • Design of small molecule inhibitors that target critical outF interactions

  • Development of peptide-based inhibitors that mimic outF binding interfaces

  • Creation of attenuated bacterial strains with modified outF for vaccine development

  • Identification of plant resistance mechanisms that interfere with T2SS function

  • Engineering of bacteriophages that target bacteria expressing specific outF variants

Can outF or the T2SS be engineered for biotechnological applications?

The T2SS represents a sophisticated protein secretion machinery that could be repurposed:

  • Engineering the T2SS, including outF, to secrete recombinant proteins of interest

  • Developing bacterial strains with modified T2SS components for industrial enzyme production

  • Creating biosensors based on T2SS assembly and function

  • Designing synthetic biology tools that utilize T2SS principles for novel applications

  • Exploiting the substrate recognition properties for protein purification technologies

What can structural studies of outF reveal about potential antimicrobial targets?

Detailed structural characterization of outF could reveal:

  • Conserved domains that could be targeted across multiple pathogens

  • Unique structural features that could enable species-specific targeting

  • Critical interfaces for protein-protein interactions essential for T2SS assembly

  • Conformational changes during secretion that could be disrupted by small molecules

  • Structure-guided design of inhibitors that block specific outF functions

What are the major technical challenges in studying outF function?

Despite significant advances, several challenges remain:

  • Difficulty in obtaining high-resolution structures of membrane-embedded outF

  • Challenges in reconstituting functional T2SS complexes in vitro

  • Limitations in real-time visualization of secretion dynamics

  • Complexity in distinguishing direct versus indirect effects of outF mutations

  • Challenges in developing specific antibodies against outF protein domains

What emerging technologies might advance outF research?

Several technological developments show promise:

  • Cryo-electron microscopy for structural determination of membrane protein complexes

  • Single-molecule tracking for monitoring outF dynamics during secretion

  • Advanced genetic tools like CRISPRi for tunable gene expression

  • Microfluidic systems for high-throughput screening of outF variants

  • Computational modeling of protein-protein interactions and conformational changes

What unresolved questions remain about outF function in the T2SS?

Key questions for future investigation include:

  • The precise mechanism by which outF couples ATPase activity to pseudopilus extension

  • How outF contributes to substrate recognition and specificity

  • The dynamics of outF interactions during different stages of secretion

  • Whether outF undergoes conformational changes during the secretion cycle

  • How outF assembly and function are regulated in response to environmental signals

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.