Recombinant Pectobacterium carotovorum subsp. carotovorum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Role in Pathogenicity

uppP is critical for P. carotovorum’s virulence. A Δupp mutant strain exhibited reduced maceration capacity in plant tissues, highlighting its role in host invasion . The enzyme’s activity ensures recycling of C55P, which is indispensable for:

  • Peptidoglycan precursor transport across the cytoplasmic membrane .

  • Bacitracin resistance by countering antibiotic-induced C55PP accumulation .

Key Findings from In Vivo Studies :

  • uppP expression increased >1.5-fold during infection in Zantedeschia elliotiana.

  • Deletion of upp disrupted cell envelope synthesis, impairing bacterial survival in plant tissues.

Biochemical Properties

While direct data on recombinant P. carotovorum uppP is limited, insights from homologous enzymes (e.g., E. coli BacA) suggest:

  • Optimal activity: Enhanced by divalent cations (e.g., Ca²⁺) .

  • Inhibitors: EDTA, Zn²⁺, and Ca²⁺ strongly inhibit activity .

  • pH stability: Functional across pH 5.0–9.0, similar to other bacterial phosphatases .

Recombinant Expression and Applications

Though recombinant production of P. carotovorum uppP is not explicitly documented, protocols for homologous enzymes involve:

  • Cloning: His-tagged constructs in E. coli or Bacillus subtilis .

  • Purification: SDS-PAGE confirms ~22–48 kDa bands, depending on species .

Potential Applications:

  • Antibiotic target: Blocking uppP could sensitize bacteria to bacitracin .

  • Enzyme engineering: Optimizing activity for industrial peptidoglycan synthesis .

Research Gaps and Future Directions

Current studies lack structural and kinetic data for P. carotovorum uppP. Priorities include:

  • Crystallization: Resolving 3D structures to guide inhibitor design.

  • In planta expression analysis: Linking enzymatic activity to virulence regulation.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; PC1_3409; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
uppP
Target Protein Sequence
MTDLHSLLIAFILGVVEGLTEFLPVSSTGHMIIVGHWLGFVDEKAKTFEVIIQLGSILAV VVMFWRRLFGLIGIHFGEVPHEGHTAGRLKLTHILLAMIPAVVLGLVFHDVIKSLFYPQN VMYALVVGGFLLLAAEWLKPKKPRAVGLDDITHRQAFMIGCFQCLALWPGFSRSGATISG GMLVGVSRYAASEFSFILAVPMMMGATVLDLYKSWHFLSLSDVPMFAVGFVTAFLVALIA IKTFLKIIKRISFVPFAIYRFIVAGVVYMVFM
Uniprot No.

Target Background

Function
This recombinant *Pectobacterium carotovorum* subsp. *carotovorum* Undecaprenyl-diphosphatase (UppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Undecaprenyl-diphosphatase (uppP) in Pectobacterium carotovorum?

Undecaprenyl pyrophosphate phosphatase (UppP) is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate. This process is essential for bacterial cell wall synthesis, as undecaprenyl phosphate serves as a carrier lipid in peptidoglycan assembly . In Pectobacterium carotovorum, this enzyme plays a crucial role in maintaining cell wall integrity, which is particularly important for a plant pathogen that must withstand various environmental stresses while infecting host tissues.

The active site of UppP is proposed to be located in the periplasm and is composed of (E/Q)XXXE and PGXSRSXXT motifs along with a histidine residue . These conserved regions are critical for the enzyme's catalytic activity and substrate binding.

How does Pectobacterium carotovorum cause plant disease?

Pectobacterium carotovorum is an economically important phytopathogen identified as a major causative agent of bacterial soft rot in various crops, particularly carrots . The pathogen employs plant cell wall-degrading enzymes, including endo-polygalacturonases, to macerate plant tissues, leading to characteristic soft rot symptoms.

When investigating P. carotovorum pathogenicity, researchers have identified differentially expressed proteins during infection. A comparative proteomics study using two-dimensional electrophoresis coupled with mass spectrometry revealed 53 differentially expressed proteins (>1.5-fold) between in vitro and in vivo conditions . These proteins play various roles in virulence, metabolism, and stress response, contributing to the bacterium's ability to successfully colonize and damage plant tissues.

What expression systems are suitable for recombinant production of P. carotovorum proteins?

Several expression systems have been successfully employed for recombinant production of P. carotovorum proteins. For example, the endo-polygalacturonase gene from P. carotovorum has been cloned into the pGAPZαA vector and constitutively expressed in Pichia pastoris . This heterologous expression system yielded functional enzyme that showed a 1.7-fold increase in secretion when glycerol replaced glucose as the carbon source in the culture medium.

For membrane proteins like UppP, E. coli expression systems with appropriate membrane-targeting sequences are commonly used. When expressing membrane proteins, consider the following strategies:

  • Use of low-copy number vectors to prevent toxicity

  • Induction at lower temperatures (16-25°C) to allow proper folding

  • Addition of specific chaperones to assist in folding

  • Use of detergents for extraction and purification

What are the key consensus regions in UppP structure?

Sequence alignment of UppP reveals two critical consensus regions essential for catalytic activity:

  • The glutamate-rich (E/Q)XXXE motif

  • The PGXSRSXXT motif

These conserved regions, along with a histidine residue, form the enzyme active site, which is proposed to be located in the periplasm . The spatial arrangement of these residues creates a binding pocket for the undecaprenyl pyrophosphate substrate and coordinates the dephosphorylation reaction.

How can I optimize the heterologous expression of P. carotovorum UppP in E. coli?

Optimizing heterologous expression of membrane proteins like UppP requires careful consideration of several factors:

Expression vector selection:

  • Use vectors with tunable promoters (like pBAD or pET with lac operators) to control expression levels

  • Consider including fusion tags that enhance solubility (MBP, SUMO) or facilitate purification (His, Strep)

Host strain optimization:

  • Select E. coli strains designed for membrane protein expression (C41, C43, Lemo21)

  • Consider strains with slower growth rates that allow proper membrane insertion

Growth and induction conditions:

  • Culture at 16-25°C post-induction to slow protein synthesis and facilitate proper folding

  • Test various inducers and concentrations (0.01-0.5 mM IPTG for T7 systems)

  • Supplement media with membrane components when appropriate

A systematic approach testing different combinations of these variables is recommended. Monitor expression by Western blotting and enzymatic activity assays to identify optimal conditions.

What approaches can be used to characterize the structural determinants of UppP substrate specificity?

To characterize structural determinants of UppP substrate specificity, employ a multifaceted approach combining computational modeling, site-directed mutagenesis, and functional assays:

Computational approaches:

  • Homology modeling using related phosphatases with known structures

  • Molecular dynamics simulations to identify putative substrate binding sites

  • Docking studies with undecaprenyl pyrophosphate and analogs

Experimental validation:

  • Site-directed mutagenesis targeting conserved residues in the (E/Q)XXXE and PGXSRSXXT motifs

  • Alanine-scanning mutagenesis of the proposed active site

  • Chimeric constructs with related phosphatases to identify specificity-determining regions

Functional characterization:

  • Enzymatic assays with varying chain length substrates (C10-C55)

  • Competition assays with substrate analogs

  • pH and ionic strength dependence of activity with different substrates

This integrated approach will provide insights into how UppP recognizes and processes its substrate, which could inform inhibitor design for antimicrobial development.

How do I design experiments to compare in vitro versus in vivo expression profiles of P. carotovorum proteins including UppP?

Designing experiments to compare in vitro versus in vivo expression profiles requires careful planning to ensure biological relevance:

In vitro system design:

  • Use minimal media supplemented with plant extracts from the target host

  • Simulate infection conditions (pH, temperature, nutrient limitations)

  • Include appropriate controls (standard media, different growth phases)

In vivo infection model:

  • Select appropriate plant host (e.g., Zantedeschia elliotiana 'Black Magic')

  • Establish consistent inoculation protocol

  • Set time points for sampling that capture early, middle, and late infection stages

Protein extraction and analysis:

  • Use two-dimensional electrophoresis coupled with mass spectrometry for global protein profiling

  • Apply strict criteria for differential expression (>1.5-fold change)

  • Confirm key findings with targeted methods (Western blot, activity assays)

When analyzing results, organize proteins by functional categories to identify biological processes affected during infection. A previous study identified 53 differentially expressed proteins between in vitro and in vivo conditions in P. carotovorum , providing a valuable reference point for comparison.

What are the experimental challenges in determining UppP membrane topology and how can they be addressed?

Determining membrane protein topology presents several challenges that can be addressed using complementary approaches:

Challenge 1: Maintaining native structure

  • Solution: Use mild detergents (DDM, LMNG) for extraction

  • Validate with multiple detergents to ensure results aren't detergent-specific

  • Consider nanodiscs or amphipols for more native-like environment

Challenge 2: Distinguishing periplasmic from cytoplasmic domains

  • Solution: Cysteine accessibility scanning

  • PhoA/LacZ fusion reporters at different positions

  • Limited proteolysis in intact versus disrupted membranes

Challenge 3: Visualizing the complete structure

  • Solution: Combine low-resolution techniques (EM, SAXS) with high-resolution methods

  • Consider crystallizing stable domains separately

  • Use computational prediction algorithms as complementary approach

Recommended workflow:

  • Start with in silico topology predictions

  • Validate experimentally using cysteine accessibility or reporter fusions

  • Refine the model using crosslinking data

  • Confirm with structural biology approaches if possible

This systematic approach will help determine whether the proposed periplasmic location of the UppP active site composed of (E/Q)XXXE and PGXSRSXXT motifs is accurate.

What methods can be used to assess UppP enzymatic activity in vitro?

Several complementary methods can be employed to assess UppP enzymatic activity:

Radioactive phosphate release assay:

  • Incubate purified UppP with [γ-32P]-labeled undecaprenyl pyrophosphate

  • Separate released 32Pi by thin-layer chromatography or extraction

  • Quantify radioactivity using scintillation counting

Colorimetric phosphate detection:

  • Use malachite green or molybdate-based assays to detect released inorganic phosphate

  • Generate standard curve with known phosphate concentrations

  • Measure absorbance at appropriate wavelength (typically 620-660 nm)

HPLC-based substrate conversion:

  • Separate substrate (undecaprenyl pyrophosphate) and product (undecaprenyl phosphate)

  • Monitor conversion rate under varying conditions

  • Quantify using integrated peak areas

Enzyme kinetics parameters that should be determined:

ParameterTypical range for UppPMethod
Km10-50 μMVarying substrate concentration
kcat5-50 s-1Time course at saturating substrate
pH optimum5.5-7.0Activity assays across pH range
Metal ion dependenceCo2+, Mg2+ enhancementActivity with/without specific ions

When designing activity assays, consider the membrane-bound nature of UppP, which may require detergents or lipid reconstitution for optimal activity.

How can I develop a robust purification protocol for recombinant UppP from P. carotovorum?

Developing a robust purification protocol for membrane proteins like UppP requires special considerations:

Step 1: Optimal cell disruption

  • Use gentle methods like enzymatic lysis with lysozyme

  • Avoid excessive sonication which can denature membrane proteins

  • Include protease inhibitors throughout the process

Step 2: Membrane isolation and solubilization

  • Isolate membrane fraction by ultracentrifugation (100,000 × g)

  • Test multiple detergents for solubilization efficiency:

    • n-Dodecyl β-D-maltoside (DDM): 0.5-1%

    • Lauryl maltose neopentyl glycol (LMNG): 0.1-0.5%

    • Digitonin: 0.5-1%

Step 3: Affinity chromatography

  • Use immobilized metal affinity chromatography (IMAC) for His-tagged UppP

  • Include detergent at CMC concentration in all buffers

  • Optimize imidazole concentration in wash buffers to minimize nonspecific binding

Step 4: Size exclusion chromatography

  • Remove aggregates and detergent micelles

  • Verify protein homogeneity and oligomeric state

  • Collect fractions corresponding to properly folded protein

Quality control checkpoints:

  • SDS-PAGE and Western blotting after each purification step

  • Enzymatic activity assays to confirm function is maintained

  • Dynamic light scattering to assess homogeneity

  • Circular dichroism to verify secondary structure integrity

This protocol should yield purified UppP suitable for structural and functional studies.

What genetic tools are available for studying P. carotovorum gene function in vivo?

Several genetic tools and approaches are available for studying P. carotovorum gene function:

Gene deletion strategies:

  • Lambda red recombination system: This method has been effectively used in related species like P. wasabiae to create gene knockouts by replacing target genes with antibiotic resistance markers .

  • CRISPR-Cas9 based genome editing: Allows for precise modifications without antibiotic markers.

Complementation approaches:

  • Plasmid-based complementation: For example, complemented strains of P. wasabiae expA mutant have been constructed by PCR amplification and cloning into vectors like Bluescript SK .

  • Chromosomal integration for stable expression.

Reporter systems:

  • Fluorescent proteins (GFP, mCherry) for visualizing gene expression and protein localization

  • LacZ fusions for quantitative expression studies

  • Luciferase reporters for real-time monitoring

Example workflow for gene deletion:

  • Design primers with 40-50 bp homology to regions flanking the target gene

  • PCR amplify antibiotic resistance cassette with these primers

  • Transform P. carotovorum cells expressing lambda red proteins

  • Select transformants on appropriate antibiotics

  • Verify deletion by PCR and sequencing

These techniques enable detailed investigation of gene function, protein interactions, and regulatory networks in P. carotovorum.

How can phage-based detection systems be utilized to study P. carotovorum interactions with UppP inhibitors?

Phage-based detection systems offer innovative approaches to study P. carotovorum interactions with UppP inhibitors:

Phage-based reporter systems:

  • Engineer P. carotovorum-specific bacteriophages (e.g., vB_PcaM_P7_Pc) to express reporter genes

  • Monitor infection efficiency in the presence of UppP inhibitors

  • Use plaque assays to quantify phage propagation under different inhibitor concentrations

Growth inhibition correlation:

  • Measure bacterial growth reduction during phage infection (typically ~81% based on OD600)

  • Determine how UppP inhibitors affect this reduction

  • Establish dose-response relationships

Methodology for phage-inhibitor studies:

  • Culture P. carotovorum to mid-log phase (OD600 ~0.4-0.6)

  • Pre-treat with various concentrations of UppP inhibitors

  • Infect with characterized phage (e.g., vB_PcaM_P7_Pc) at optimal MOI

  • Monitor bacterial lysis kinetics by tracking OD600 over time

  • Compare lysis curves between inhibitor-treated and untreated cultures

This approach leverages the natural infection cycle of P. carotovorum-specific phages to provide insights into how UppP inhibitors affect cell wall synthesis and bacterial viability.

How are genomics approaches enhancing our understanding of P. carotovorum UppP and related pathways?

Genomics approaches are significantly advancing our understanding of P. carotovorum UppP and related pathways:

Comparative genomics:
Recent studies employing genome-informed diagnostics have enabled specific and rapid detection of Pectobacterium species . These approaches identify conserved genes that can serve as targets for detection and classification, providing insights into essential genes like uppP.

Transcriptomics integration:
RNA extraction protocols optimized for Pectobacterium species allow for detailed transcriptomic analysis under various conditions . This reveals the regulatory networks controlling uppP expression and identifies co-regulated genes involved in cell wall synthesis.

Future applications:
As more Pectobacterium genomes are sequenced and compared, our understanding of evolutionary conservation in cell wall synthesis pathways will improve. This knowledge will inform more targeted approaches to pathogen control through specific inhibition of essential processes like those mediated by UppP.

What are the emerging technologies for studying membrane protein-ligand interactions applicable to UppP research?

Several cutting-edge technologies are transforming how researchers study membrane protein-ligand interactions:

Cryo-electron microscopy (cryo-EM):
Recent advances in detector technology and image processing have made it possible to determine high-resolution structures of membrane proteins without crystallization. This approach could reveal detailed UppP-substrate interactions in a near-native environment.

Native mass spectrometry:
This technique allows for the analysis of intact membrane protein complexes and their interactions with ligands, providing insights into binding stoichiometry and affinity under near-native conditions.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS):
HDX-MS can map ligand binding sites and conformational changes in membrane proteins like UppP by measuring the exchange rates of backbone amide hydrogens with deuterium from the solvent.

Single-molecule FRET:
By labeling UppP and monitoring fluorescence resonance energy transfer, researchers can observe conformational dynamics during substrate binding and catalysis at the single-molecule level.

Surface plasmon resonance (SPR) with nanodiscs:
Incorporating UppP into nanodiscs allows for SPR measurements of binding kinetics in a membrane-like environment, providing quantitative data on inhibitor interactions.

These technologies offer unprecedented insights into how UppP recognizes and processes its substrate, which could guide the development of specific inhibitors as potential antimicrobials.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.