Recombinant Pectobacterium carotovorum subsp. carotovorum Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
arnC; PC1_2927; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
arnC
Target Protein Sequence
MIDDIKNVSVVIPVYNEEESLPVLIERTLAACRQIGKPWEIILVDDGSSDRSAELLTEAA SDPEKHIIAVLLNRNYGQHSAIMAGFQQAVGDVVITLDADLQNPPEEIPRLVEYAAQGYD VVGTVRANRQDSLFRKLASKTINMMIRRSTGKSMADYGCMLRAYRRHIVSAMLHCHERST FIPILANTFARKTIEIDVMHAEREFGTSKYSFLKLINLMYDLLTCLTTTPLRILSLIGSV VALSGFLLALLLIGLRLFLGAEWAAEGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYTDV RARPRYFVQKTVSAATPLTTSLRDEEE
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do environmental factors affect arnC expression in Pectobacterium carotovorum?

Expression of arnC in P. carotovorum, like other genes involved in cell envelope modification, is likely modulated by environmental factors that signal stress or host-associated conditions. Temperature has been demonstrated to significantly affect gene expression in P. carotovorum, as evidenced by the differential expression of genes involved in bacteriocin production and virulence factors at different temperatures .

Based on related regulatory systems in P. carotovorum, we can propose that arnC expression may be affected by:

  • Temperature variation (23°C vs. 30°C, which differentially affects other genes in P. carotovorum)

  • DNA-damaging agents (which activate the RecA-RdgA-RdgB regulatory cascade)

  • Low Mg²⁺ conditions (which typically activate PhoPQ and PmrAB systems in related bacteria)

  • Acidic pH (which can trigger LPS modifications)

To study these effects experimentally, quantitative reverse transcription PCR (RT-qPCR) methods similar to those used for rdgB and pnl gene expression analysis in P. carotovorum can be employed . When conducting such experiments, researchers should use appropriate reference genes for normalization, such as the 16S rRNA gene, as demonstrated in studies of P. carotovorum gene expression .

What are the optimal conditions for heterologous expression of recombinant P. carotovorum arnC?

Recombinant expression of membrane-associated proteins like arnC presents significant challenges. Based on successful approaches for similar proteins and known properties of P. carotovorum proteins, the following methodological recommendations can be made:

Expression System Selection:

Expression SystemAdvantagesConsiderations for arnC
E. coli BL21(DE3)High yield, easy manipulationMay require codon optimization for P. carotovorum genes
E. coli C43(DE3)Specialized for membrane proteinsBetter for maintaining protein solubility
E. coli RosettaSupplies rare tRNAsUseful if P. carotovorum uses rare codons
Pichia pastorisPost-translational modificationsLonger development time but potentially better folding

Optimization Parameters:

  • Induction temperature: Lower temperatures (16-23°C) often improve solubility of membrane-associated proteins and may be particularly appropriate given the temperature-sensitivity observed in P. carotovorum gene expression systems .

  • Inducer concentration: For IPTG-based systems, concentrations between 0.1-0.5 mM typically provide optimal balance between expression and solubility.

  • Expression time: Extended expression (16-24 hours) at lower temperatures often yields better results than shorter periods at higher temperatures.

For constructing expression vectors, researchers can employ PCR-based strategies similar to those used for rdgB cloning from P. carotovorum, using specifically designed primers to ensure proper reading frame and inclusion of purification tags .

What purification strategy yields the highest purity and activity for recombinant arnC?

Purification of recombinant arnC from P. carotovorum requires specialized approaches due to its membrane association and glycosyltransferase activity. A multi-step purification strategy is recommended:

Step 1: Membrane Fraction Isolation

  • Harvest cells and disrupt by sonication or French press

  • Separate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilize membrane proteins using detergents

Step 2: Detergent Selection
The choice of detergent is critical for maintaining enzyme activity:

DetergentConcentrationComments for arnC Purification
DDM1-2%Mild, often preserves activity
LDAO1%Effective for many membrane proteins
CHAPS0.5-1%Zwittérionic, less denaturing
Triton X-1001%Good solubilizing properties but may affect activity

Step 3: Affinity Chromatography

  • His₆-tagged constructs can be purified using Ni-NTA chromatography

  • For construction of His₆-tagged proteins, primer design strategies similar to those used for RdgB from P. carotovorum can be adapted

  • Elution using imidazole gradient (50-300 mM)

Step 4: Size Exclusion Chromatography

  • Further purification and buffer exchange

  • Assessment of oligomeric state

  • Verification of protein quality by SDS-PAGE

Activity measurements should be performed immediately after purification, as glycosyltransferases can lose activity during storage. Similar to the DNA-binding assays performed for RdgB characterization, activity assays for arnC should be optimized to determine optimal pH, temperature, and cofactor requirements .

What in vitro assays can be used to measure the enzymatic activity of P. carotovorum arnC?

Several complementary approaches can be employed to measure the glycosyltransferase activity of arnC:

1. Radiochemical Assay:

  • Substrate: ¹⁴C-labeled UDP-4-amino-4-deoxy-L-arabinose

  • Measure transfer to undecaprenyl phosphate

  • Quantify by scintillation counting after phase separation

  • Advantages: High sensitivity, quantitative

  • Limitations: Requires radioisotope handling facilities

2. HPLC-Based Assay:

  • Monitor consumption of UDP-4-amino-4-deoxy-L-arabinose

  • Quantify formation of modified undecaprenyl phosphate

  • Advantages: No radioisotopes required, good sensitivity

  • Limitations: Requires specific HPLC columns and detection methods

3. Coupled Enzyme Assay:

  • Monitor release of UDP during glycosyl transfer

  • Couple to UDP-glucose pyrophosphorylase and measure pyrophosphate release

  • Advantages: Continuous monitoring, adaptable to plate format

  • Limitations: Potential interference from coupling enzymes

4. Mass Spectrometry Analysis:

  • Direct detection of modified undecaprenyl phosphate

  • Provides structural confirmation of product

  • Advantages: High specificity, structural information

  • Limitations: Specialized equipment, not easily quantitative

When establishing these assays, researchers should carefully optimize reaction conditions, considering the temperature sensitivity observed in other P. carotovorum enzymes. Based on studies of related systems, optimal activity may be observed at temperatures between 23-30°C, reflecting the temperature-dependent expression patterns observed for other P. carotovorum genes .

How do modifications to lipopolysaccharide via arnC affect antimicrobial resistance in P. carotovorum?

The modification of lipopolysaccharide (LPS) through the addition of 4-amino-4-deoxy-L-arabinose to lipid A is a key mechanism for antimicrobial peptide resistance in gram-negative bacteria. In P. carotovorum, this modification likely contributes to environmental persistence and host interactions.

Methodology for Assessing Resistance Phenotypes:

  • Minimum Inhibitory Concentration (MIC) Testing:

    • Compare wild-type, arnC knockout, and arnC-complemented strains

    • Test against various antimicrobial peptides (polymyxins, defensins)

    • Assess impact of environmental conditions on resistance profiles

  • LPS Modification Analysis:

    • Extract LPS from bacterial cultures grown under different conditions

    • Analyze lipid A modifications by mass spectrometry

    • Correlate modifications with resistance phenotypes

  • Gene Expression Correlation:

    • Measure arnC expression levels using RT-qPCR under different growth conditions

    • Correlate with antimicrobial resistance profiles

    • Use methodologies similar to those employed for rdgB expression analysis in P. carotovorum

The RecA-RdgA-RdgB regulatory pathway in P. carotovorum responds to DNA damage and activates various stress response genes . This system potentially intersects with arnC regulation, particularly under conditions that threaten cellular integrity. Exploration of these regulatory connections could provide insight into coordinated stress responses in P. carotovorum.

What crystallization approaches are most successful for membrane-associated transferases like P. carotovorum arnC?

Crystallization of membrane-associated proteins presents significant challenges due to their hydrophobic surfaces and requirement for detergents. For P. carotovorum arnC, several specialized approaches can be considered:

1. Detergent-Based Crystallization:

  • Screen multiple detergents at various concentrations

  • Commonly successful detergents include DDM, LDAO, and C8E4

  • Consider adding lipids to stabilize protein in native-like environment

2. Lipidic Cubic Phase (LCP) Crystallization:

  • Embed protein in monoolein-based mesophase

  • Particularly successful for membrane proteins

  • Allows proteins to maintain lipid interactions

3. Protein Engineering Approaches:

  • Truncate flexible termini based on secondary structure predictions

  • Consider fusion partners (T4 lysozyme, BRIL) to increase soluble surface area

  • Remove putative glycosylation sites if using eukaryotic expression systems

4. Co-crystallization Strategies:

  • Include substrate analogues or product mimics to stabilize active site

  • Consider co-crystallization with binding partners or antibody fragments

The temperature sensitivity observed in P. carotovorum protein activities suggests that crystallization trials should be performed at multiple temperatures, particularly focusing on the range of 16-25°C where other P. carotovorum proteins show optimal activity .

How can molecular dynamics simulations complement experimental studies of arnC function?

Molecular dynamics (MD) simulations provide valuable insights into protein dynamics and substrate interactions that may be difficult to capture experimentally. For P. carotovorum arnC, computational approaches can address several key questions:

Simulation Approaches and Applications:

Simulation TypeApplication to arnCTechnical Considerations
Classical MDMembrane insertion dynamics, substrate bindingRequires accurate membrane parameters
Steered MDSubstrate entry/exit pathwaysNeeds careful force constant selection
QM/MMDetailed reaction mechanismComputationally intensive, focus on active site
Coarse-grained MDLong-timescale conformational changesSacrifices atomic detail for sampling

Key Research Questions Addressable by MD:

  • How does arnC interact with the bacterial membrane?

  • What conformational changes occur during catalysis?

  • How do substrates access the active site?

  • What is the impact of temperature on protein dynamics, particularly in the context of the temperature-dependent activity observed in P. carotovorum systems ?

These computational approaches should be integrated with experimental data to develop a comprehensive understanding of arnC function. The temperature-dependent behavior observed in other P. carotovorum systems suggests that simulations at different temperatures (particularly 23°C and 30°C) might reveal important differences in protein dynamics that correlate with enzymatic activity .

How conserved is arnC across different Pectobacterium species and what does this reveal about its evolutionary importance?

Comparative genomic analysis of arnC across Pectobacterium species provides insight into its evolutionary conservation and functional importance. Research approaches should include:

1. Sequence Conservation Analysis:

  • Multiple sequence alignment of arnC orthologs across Pectobacterium species

  • Identification of highly conserved regions, likely corresponding to catalytic and substrate-binding domains

  • Analysis of selection pressure (dN/dS ratios) to identify regions under purifying or diversifying selection

2. Synteny Analysis:

  • Examination of gene order conservation in the arn operon

  • Identification of species-specific gene arrangements or insertions

  • Correlation with ecological niches and host ranges

3. Phylogenetic Analysis:

  • Construction of phylogenetic trees based on arnC sequences

  • Comparison with species trees to identify potential horizontal gene transfer events

  • Analysis of coevolution with other LPS biosynthesis genes

This comparative approach may reveal adaptations specific to P. carotovorum subsp. carotovorum in different environments. The observed temperature-dependent regulation of virulence factors in P. carotovorum suggests that arnC may show similar adaptations, potentially contributing to the bacterium's ability to infect different hosts under varying conditions .

Can recombinant P. carotovorum arnC complement arnC mutations in other bacterial species?

Cross-species complementation studies provide valuable insights into functional conservation and species-specific adaptations. For arnC from P. carotovorum, the following methodological approaches are recommended:

Experimental Design:

  • Generate arnC deletion mutants in model organisms (E. coli, Salmonella) and in different Pectobacterium species

  • Construct expression vectors containing P. carotovorum arnC under both native and heterologous promoters

  • Transform deletion mutants with these constructs

  • Assess complementation through:

    • Antimicrobial peptide resistance restoration

    • LPS modification analysis by mass spectrometry

    • Growth under stress conditions

Potential Outcomes and Interpretations:

Complementation ResultInterpretationFurther Studies
Full complementationHigh functional conservationFocus on shared regulatory mechanisms
Partial complementationSome species-specific adaptationsIdentify critical residues through mutagenesis
No complementationSignificant divergence in function or regulationInvestigate species-specific substrates or partners

When designing complementation constructs, researchers can utilize strategies similar to those employed for RdgB complementation in P. carotovorum, including appropriate promoter selection and consideration of temperature effects on expression . The optimal expression temperature may differ between species, reflecting the temperature-dependent gene expression observed in P. carotovorum .

How does arnC contribute to P. carotovorum pathogenicity in different host plants?

P. carotovorum is an economically important phytopathogen causing bacterial soft rot in various crops, including carrots . The role of arnC in this pathogenicity can be investigated through:

1. Virulence Assays:

  • Generate arnC deletion and overexpression strains

  • Perform infection assays on various plant hosts (carrots, potatoes, etc.)

  • Quantify tissue maceration, bacterial proliferation, and disease progression

  • Compare responses at different temperatures, considering the temperature-dependent virulence observed in P. carotovorum

2. Host Defense Response Analysis:

  • Measure plant antimicrobial peptide production in response to wild-type vs. arnC mutant infection

  • Analyze plant defense gene expression profiles

  • Assess reactive oxygen species production and other defense responses

3. In planta Bacterial Gene Expression:

  • Quantify arnC expression during different stages of infection

  • Compare expression patterns in different host plants

  • Correlate with expression of known virulence factors such as pectin lyase (Pnl), which is regulated by RdgB in P. carotovorum

These approaches can determine whether arnC contributes to the ability of P. carotovorum to cause significant harvest losses in economically important crops like carrots . The potential regulatory connection with the RecA-RdgA-RdgB pathway, which is known to affect P. carotovorum pathogenicity, warrants particular investigation .

How can understanding arnC function contribute to novel control strategies for bacterial soft rot?

Bacterial soft rot caused by P. carotovorum leads to significant economic losses in agriculture . Understanding arnC function can inform novel control strategies:

1. Target-Based Inhibitor Development:

  • Design specific inhibitors of arnC through structure-based approaches

  • Screen compound libraries for inhibitors of arnC activity

  • Evaluate efficacy of inhibitors in reducing bacterial viability and virulence

  • Assess specificity to avoid impacts on beneficial microbes

2. Integration with Phage Biocontrol:

  • Evaluate whether arnC modifications affect phage recognition and binding

  • Determine if phages like vB_PcaM_P7_Pc, which infect P. carotovorum, interact with LPS structures modified by arnC

  • Design combination approaches using phage biocontrol and arnC inhibitors

  • Assess synergistic effects in field conditions

3. Resistance Management Strategies:

  • Monitor potential evolution of resistance to arnC inhibitors

  • Develop rotation strategies with other control methods

  • Integrate with agricultural practices to minimize disease pressure

Current control measures for bacterial soft rot are not fully efficient , and phage-mediated biocontrol strategies are being explored as alternatives to chemical control . Understanding arnC's role in bacterial survival and host interaction could complement these approaches, potentially increasing their efficacy through targeted combination strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.