Recombinant Pectobacterium carotovorum subsp. carotovorum Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant UspB is synthesized using plasmid vectors (e.g., pHT43) under inducible promoters. Technical specifications for production include:

ParameterAviva Cusabio
Expression HostE. coliE. coli
TagHis tagHis tag (determined during manufacturing)
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Storage BufferTris/PBS + 50% glycerolTris-based buffer + 50% glycerol
ReconstitutionLyophilized powder in sterile water Lyophilized powder in sterile water

Functional and Biochemical Properties

UspB is implicated in stress response pathways, though direct functional studies in Pectobacterium remain limited. Key biochemical data from recombinant variants include:

Table 3: Biochemical Activity and Stability

ParameterFindings
Optimal pHNot explicitly tested; inferred stability in Tris/PBS buffers (pH 8.0)
Thermal StabilityStable at -80°C long-term; avoid freeze-thaw cycles
Metal Ion EffectsNo direct data; His tag allows nickel-affinity chromatography purification

Research Applications

Recombinant UspB is primarily used for:

  • Antibody Production: Immunogen for generating polyclonal/monoclonal antibodies .

  • Enzymatic Assays: Substrate for studying ATP-binding or stress-response mechanisms .

  • Pathogenicity Studies: Comparative analysis of Pectobacterium stress adaptations .

Limitations and Future Directions

Current limitations include:

  • Lack of in planta functional validation for UspB’s role in virulence .

  • Limited structural data (e.g., crystallography) to resolve mechanistic details .

Future research could explore UspB’s interaction with host plants or its regulatory role in bacterial stress pathways.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please specify it and we will prioritize developing the requested tag.
Synonyms
uspB; PC1_4202; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
uspB
Target Protein Sequence
MISTFALFWALCIVCIINMARYYSSLRVLLLVLRDCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIYAQRYLDHHDPEFIRRCERVRGQFLLTTALCGLIVISLIAMMIWY
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pectobacterium carotovorum and why is it important in plant pathology research?

Pectobacterium carotovorum is a gram-negative bacterial phytopathogen belonging to the family Enterobacteriaceae. It is a destructive pathogen causing soft rot disease in various crops, particularly potatoes. P. carotovorum produces plant cell wall-degrading enzymes (PCWDEs) that break down plant tissue, resulting in characteristic soft rot symptoms . The significance of this pathogen lies in its ability to cause substantial economic losses in agriculture, particularly in potato production where it causes blackleg in the field and soft rot during post-harvest storage . Researchers focus on this organism to understand bacterial pathogenesis mechanisms and to develop effective disease management strategies.

What are Universal Stress Proteins and what is the specific role of uspB in P. carotovorum?

Universal Stress Proteins (USPs) are a conserved group of proteins in bacteria that are typically upregulated in response to various environmental stressors, including nutrient starvation, oxidative stress, and temperature changes. While the specific function of uspB in P. carotovorum has not been fully characterized in the provided research, we can infer from studies on related bacterial species that uspB likely plays a critical role in stress response and adaptation during host colonization. Similar to other stress proteins identified in P. carotovorum (such as ClpP, MreB, and FlgK), uspB may contribute to bacterial survival during plant infection and influence virulence .

How does uspB expression change during plant infection compared to in vitro growth?

Based on research methodologies used to study other P. carotovorum proteins, uspB expression likely differs between in vitro and in vivo conditions. Similar to the 53 differentially expressed proteins identified in P. carotovorum strain PccS1 when comparing growth in culture medium versus plant tissue, uspB expression may be upregulated during actual plant infection . Studies comparing protein expression profiles using two-dimensional electrophoresis (2-DE) coupled with mass spectrometry would be needed to precisely quantify these changes. Some virulence-associated proteins in P. carotovorum show up to 10-fold upregulation during plant infection compared to growth in plant extract-supplemented media .

What are the most effective methods for cloning and expressing recombinant uspB from P. carotovorum?

For cloning and expressing recombinant uspB from P. carotovorum, researchers should follow these methodological steps:

  • Gene amplification: Design specific primers based on the P. carotovorum genome sequence to amplify the uspB gene. PCR conditions should be optimized using high-fidelity DNA polymerase to minimize errors.

  • Vector selection: Choose an appropriate expression vector (pET series vectors are commonly used) with suitable promoter, tag sequence, and antibiotic resistance marker.

  • Transformation and expression: Transform the recombinant vector into an appropriate E. coli expression strain (BL21(DE3) or its derivatives). Induce protein expression using IPTG at optimized concentration (typically 0.1-1.0 mM) and temperature (15-37°C).

  • Protein purification: Use affinity chromatography (His-tag or GST-tag) followed by size exclusion chromatography to obtain pure protein.

  • Validation: Confirm protein identity using techniques like Western blotting and mass spectrometry.

For optimal expression, consider using codon-optimized synthetic genes if the natural P. carotovorum uspB sequence contains rare codons that might impede expression in E. coli.

How should researchers design experiments to assess uspB function in stress response?

To assess uspB function in stress response, researchers should implement a comprehensive experimental design that includes:

  • Gene knockout studies: Create a ΔuspB mutant in P. carotovorum using homologous recombination or CRISPR-Cas9 systems. Complementation with wild-type uspB gene should be performed to confirm phenotypic changes are due to uspB deletion.

  • Stress challenge assays: Subject both wild-type and ΔuspB mutant strains to various stressors:

    • Oxidative stress (H₂O₂, paraquat)

    • Osmotic stress (NaCl, sucrose)

    • pH stress (acidic/alkaline conditions)

    • Temperature stress (heat/cold shock)

    • Nutrient limitation

  • Growth curve analysis: Monitor bacterial growth under stress conditions at multiple time points (0, 2, 4, 8, 12, 24, 48 hours).

  • Quantitative proteomics: Analyze changes in the bacterial proteome under stress conditions using 2-DE coupled with mass spectrometry, similar to methods used in previous P. carotovorum studies .

  • Transcriptome analysis: Perform RNA-Seq to identify genes that are differentially expressed in the ΔuspB mutant compared to wild-type under various stress conditions.

  • In planta assays: Assess virulence and colonization abilities of wild-type versus ΔuspB mutant using appropriate plant hosts, measuring bacterial populations and disease symptoms over time.

This multi-faceted approach allows for comprehensive characterization of uspB function across different stress conditions.

What controls should be included when studying recombinant uspB expression and function?

When studying recombinant uspB, the following controls are essential for accurate interpretation of results:

  • Negative controls:

    • Empty vector control (vector without uspB gene)

    • Non-induced cultures to assess leaky expression

    • Host cells without vector to establish baseline measurements

  • Positive controls:

    • Well-characterized recombinant protein expressed in the same system

    • Commercially available universal stress proteins from related bacteria

  • Complementation controls:

    • ΔuspB mutant complemented with wild-type uspB gene

    • ΔuspB mutant with vector-only (for comparative analysis)

  • Experimental condition controls:

    • Wild-type P. carotovorum strain under identical conditions

    • Time-point controls to establish expression kinetics

    • Technical and biological replicates (minimum three of each)

  • In vivo controls:

    • Mock-inoculated plant tissues

    • Plants inoculated with heat-killed bacteria

    • Sampling of uninoculated plant tissue adjacent to inoculation sites

These controls ensure that observed phenotypes are specifically attributed to uspB function and not to experimental artifacts or secondary effects.

What bioinformatic tools are most appropriate for analyzing uspB sequence and structure?

For comprehensive analysis of uspB sequence and structure, researchers should employ a combination of the following bioinformatic tools:

  • Sequence analysis:

    • BLAST (Basic Local Alignment Search Tool) for homology searches

    • Multiple Sequence Alignment tools (MUSCLE, Clustal Omega, T-Coffee)

    • Phylogenetic analysis software (MEGA, PhyML, MrBayes)

    • Domain prediction (InterProScan, PFAM, SMART)

  • Structural analysis:

    • Secondary structure prediction (PSIPRED, JPred)

    • 3D structure prediction (AlphaFold2, I-TASSER, Phyre2)

    • Molecular visualization tools (PyMOL, UCSF Chimera)

    • Molecular dynamics simulation (GROMACS, AMBER)

  • Functional prediction:

    • Protein-protein interaction prediction (STRING, PSICQUIC)

    • Ligand binding site prediction (CASTp, COACH)

    • Gene ontology analysis (PANTHER, DAVID)

  • Comparative genomics:

    • Synteny analysis (SynMap, MCScanX)

    • Identification of conserved regulatory elements (MEME Suite)

These tools should be used in a complementary manner to build a comprehensive understanding of uspB's structural features and potential functional mechanisms in P. carotovorum.

How can researchers effectively compare uspB expression levels between in vitro and in vivo conditions?

To effectively compare uspB expression levels between in vitro and in vivo conditions, researchers should employ a methodology similar to that used for other P. carotovorum proteins :

  • Sample preparation:

    • In vitro: Culture P. carotovorum in Luria-Bertani (LB) medium with and without plant extracts

    • In vivo: Inoculate host plants with P. carotovorum and collect bacterial cells at various time points (8, 16, 24, 48, 72 hours) post-inoculation

  • Bacterial recovery from plant tissues:

    • Carefully extract bacterial cells from infected plant tissues

    • Verify absence of bacterial contamination in negative controls

    • Ensure sufficient quantities of protein extract for analysis (typically visible at 16 hours after inoculation)

  • Quantification methods:

    • Transcriptional analysis: RT-qPCR using uspB-specific primers

    • Protein analysis: 2-DE coupled with mass spectrometry

    • Western blotting with uspB-specific antibodies

    • Fluorescent reporter assays using uspB promoter fusions

  • Data normalization and statistical analysis:

    • Use multiple reference genes/proteins for normalization

    • Apply appropriate statistical tests (ANOVA, t-test)

    • Consider fold-change thresholds (typically >1.5-fold considered significant)

    • Perform biological replicates (minimum three)

This approach allows for robust comparison of uspB expression patterns, identifying potential differential regulation between laboratory and natural infection conditions.

What statistical methods are appropriate for analyzing uspB mutant phenotypes compared to wild-type strains?

For rigorous statistical analysis of uspB mutant phenotypes compared to wild-type strains, researchers should implement:

  • Descriptive statistics:

    • Central tendency measures (mean, median)

    • Dispersion measures (standard deviation, standard error)

    • Graphical representation (box plots, scatter plots)

  • Inferential statistics:

    • Two-sample t-tests for single time point comparisons

    • ANOVA for multiple group comparisons followed by post-hoc tests (Tukey's HSD test)

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) if data violates normality assumptions

  • Time-series analysis:

    • Repeated measures ANOVA for growth curves

    • Area under the curve (AUC) analysis

    • Linear mixed-effects models for longitudinal data

  • Correlation analysis:

    • Pearson or Spearman correlation to assess relationships between bacterial populations and disease progression

    • Regression analysis to determine relationship strength (slope of regression line, β)

  • Multiple testing correction:

    • Bonferroni, Holm, or Benjamini-Hochberg procedures to control false discovery rate

Statistical significance thresholds should be clearly defined (typically p < 0.05), and exact p-values should be reported (e.g., p = 1.01e−03 as seen in previous P. carotovorum studies) .

How might uspB interact with quorum sensing mechanisms in P. carotovorum?

Based on studies of quorum sensing in P. carotovorum , uspB may interact with this signaling system in several ways:

  • Regulatory connections: uspB expression might be regulated by quorum sensing master regulators like ExpR or potentially influenced by AHL (acyl homoserine lactone) concentrations. Similar to other virulence factors in P. carotovorum, uspB could be part of the quorum sensing regulon.

  • Stress response coordination: Quorum sensing in P. carotovorum regulates the production of PCWDEs and virulence factors . During host colonization, uspB could serve as a stress response mediator that helps coordinate population density signals with appropriate stress adaptations.

  • Biofilm formation: The quorum sensing system in P. carotovorum influences aggregation and biofilm formation in plant tissues . uspB might play a role in bacterial survival within these aggregates, potentially helping cells tolerate stress conditions within biofilm microenvironments.

  • Vascular colonization: P. carotovorum quorum sensing mutants (ΔexpI) show different colonization patterns in plant tissues compared to wild-type strains, particularly in their ability to transit to xylem tissue . uspB could potentially influence this process by mediating stress responses during different stages of infection.

  • Motility regulation: Quorum sensing regulates flagella formation and motility in P. carotovorum . uspB might interact with these systems, potentially affecting bacterial movement in response to stress conditions during infection.

Experimental approaches similar to those used with expI mutants could reveal potential connections between uspB and quorum sensing systems in P. carotovorum.

What role might uspB play in the interaction between P. carotovorum and other microorganisms in the plant environment?

Based on studies of P. carotovorum interactions with other microorganisms , uspB may potentially influence these interactions through:

  • Interspecies competition: Similar to how P. carotovorum populations are reduced in the presence of Salmonella enterica , uspB might mediate stress responses during competitive interactions with other microorganisms in the phyllosphere.

  • Stress adaptation during co-infection: When P. carotovorum co-exists with human pathogens like S. enterica or E. coli O157:H7, uspB could be involved in adapting to changing microenvironmental conditions caused by these interactions.

  • Survival during antagonistic interactions: Some microorganisms may produce antimicrobial compounds that inhibit P. carotovorum. uspB could help the bacterium survive these antagonistic effects, similar to how the budB pathway becomes particularly important for P. carotovorum fitness in the presence of S. enterica .

  • Environmental persistence: uspB might contribute to P. carotovorum survival in plant environments when faced with competition from the native microbiota, potentially influencing the pathogen's ability to establish and maintain infections.

  • Biofilm development in polymicrobial contexts: uspB could play a role in P. carotovorum's ability to form or join multispecies biofilms, which are common in plant environments and can affect virulence.

Experimental approaches to study these interactions could include co-inoculation experiments with different microorganisms, similar to those conducted with S. enterica and P. carotovorum , while monitoring uspB expression and the phenotypes of uspB mutants.

How can structural biology approaches enhance our understanding of uspB function in P. carotovorum?

Structural biology approaches provide crucial insights into uspB function through:

  • Tertiary structure determination: X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can reveal the three-dimensional structure of recombinant uspB, identifying functional domains, active sites, and potential ligand-binding pockets.

  • Ligand binding studies:

    • Isothermal titration calorimetry (ITC) to measure binding affinities

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Nuclear magnetic resonance (NMR) for mapping binding interfaces

    • Thermal shift assays to identify stabilizing ligands

  • Conformational dynamics:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Small-angle X-ray scattering (SAXS) for solution-state conformations

    • Molecular dynamics simulations to model protein flexibility

  • Protein-protein interactions:

    • Co-immunoprecipitation coupled with mass spectrometry

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Biolayer interferometry for interaction kinetics

  • Structure-guided mutagenesis:

    • Identify critical residues for function based on structural data

    • Create point mutations to test hypotheses about structure-function relationships

    • Analyze effects in both in vitro assays and in planta experiments

These approaches can help identify potential molecular mechanisms of uspB in stress response, guide rational design of inhibitors, and provide evolutionary insights through structural comparisons with homologs from other species.

What are common challenges in expressing recombinant uspB and how can they be overcome?

Common challenges in expressing recombinant uspB from P. carotovorum and their solutions include:

  • Insoluble protein/inclusion bodies:

    • Reduce expression temperature (15-20°C)

    • Use solubility-enhancing fusion tags (SUMO, MBP, TrxA)

    • Optimize induction conditions (lower IPTG concentration, 0.1-0.2 mM)

    • Try auto-induction media instead of IPTG induction

    • Use specialized E. coli strains designed for difficult proteins (Arctic Express, Rosetta)

  • Low expression levels:

    • Codon optimization for E. coli

    • Try different promoter systems

    • Screen multiple growth media formulations

    • Extend expression time at lower temperatures

  • Protein degradation:

    • Add protease inhibitors during purification

    • Use E. coli strains lacking specific proteases (BL21)

    • Optimize buffer conditions (pH, salt concentration)

    • Include stabilizing agents (glycerol, reducing agents)

  • Poor protein folding:

    • Co-express with molecular chaperones (GroEL/ES, DnaK)

    • Include folding enhancers in purification buffers

    • Try in vitro refolding protocols if inclusion bodies are unavoidable

  • Protein aggregation during purification:

    • Add detergents or stabilizing agents

    • Optimize protein concentration steps

    • Use size exclusion chromatography as a final polishing step

    • Store in appropriate buffer conditions with stabilizing agents

For each challenge, systematic optimization of expression conditions through small-scale test expressions is recommended before scaling up production.

How can researchers optimize PCR-based detection methods for uspB gene variants in different P. carotovorum strains?

To optimize PCR-based detection of uspB gene variants across different P. carotovorum strains, researchers should implement strategies similar to those used for other P. carotovorum genes :

  • Primer design optimization:

    • Analyze multiple genome sequences to identify conserved regions flanking uspB

    • Design primers on variable segments of the gene to distinguish variants

    • Consider using degenerate primers to accommodate sequence variations

    • Perform in silico PCR analysis to verify primer specificity

  • PCR condition optimization:

    • Use touchdown PCR protocols to improve specificity

    • Optimize annealing temperatures through gradient PCR

    • Test different polymerases (high-fidelity enzymes for sequencing, robust enzymes for routine detection)

    • Adjust Mg²⁺ concentrations and buffer compositions

  • Multiplex PCR development:

    • Design compatible primer sets for simultaneous detection of uspB and other relevant genes

    • Balance primer concentrations to ensure even amplification

    • Include internal controls to verify PCR success

  • Real-time PCR adaptation:

    • Develop TaqMan or SYBR Green-based qPCR assays

    • Design probes specific to different uspB variants

    • Establish standard curves using known concentrations of template

    • Adapt assays for quantitative measurement of uspB expression levels

  • Validation protocol:

    • Test primers against a diverse collection of P. carotovorum strains

    • Include closely related species to confirm specificity

    • Sequence amplicons to verify target identity

    • Determine detection limits and quantification ranges

This approach would create a robust PCR-based detection system for uspB variants, facilitating comparative studies across different P. carotovorum isolates.

What methodological approaches can help resolve contradictory findings about uspB function in P. carotovorum?

To resolve contradictory findings about uspB function in P. carotovorum, researchers should implement these methodological approaches:

  • Standardization of experimental conditions:

    • Define standard growth conditions, media compositions, and bacterial growth phases

    • Establish uniform stress application protocols

    • Use consistent plant varieties and growth conditions for in planta studies

    • Create reference strain collections accessible to all researchers

  • Multi-method validation:

    • Triangulate findings using complementary techniques

    • Combine genetic, biochemical, and phenotypic approaches

    • Validate key findings using both in vitro and in vivo systems

    • Implement new technologies alongside established methods

  • Rigorous genetic complementation:

    • Perform allelic replacement to create clean deletions

    • Use both chromosomal and plasmid-based complementation

    • Test multiple expression levels of the complementing gene

    • Include silent mutations to distinguish complementation constructs

  • Strain comparison studies:

    • Test uspB function across multiple P. carotovorum strains

    • Analyze uspB sequence variations and correlate with functional differences

    • Consider the genetic background effects on uspB phenotypes

  • Meta-analysis of published data:

    • Systematically review existing literature

    • Identify methodological differences between studies

    • Re-analyze raw data where available

    • Develop consensus models that reconcile divergent findings

  • Collaborative multi-laboratory studies:

    • Conduct blind studies across different laboratories

    • Share materials, strains, and protocols

    • Establish agreed-upon benchmarks and controls

    • Publish comprehensive methodological details

Comparison of uspB gene sequences across Pectobacterium species

Species/SubspeciesGene Length (bp)GC Content (%)Protein Length (aa)Conserved DomainsNotable Sequence Features
P. carotovorum subsp. carotovorum~435-450~51-52~145-150ATP-binding domainConserved ATP-binding motif
P. carotovorum subsp. brasiliense~435-450~51-52~145-150ATP-binding domainSubspecies-specific SNPs
P. carotovorum subsp. odoriferum~435-450~51-52~145-150ATP-binding domainVariable C-terminal region
P. atrosepticum~435-450~50-51~145-150ATP-binding domainSpecies-specific indels
P. parmentieri~435-450~50-51~145-150ATP-binding domainHigher sequence divergence
P. versatile~435-450~51-52~145-150ATP-binding domainHighly similar to P. carotovorum

Note: This table represents expected ranges based on known characteristics of universal stress proteins in related bacteria. Exact values would require genome sequence analysis of multiple strains.

Optimized protocol for recombinant uspB expression in E. coli

StepParameterRecommended ConditionsAlternative ConditionsCritical Notes
Vector SelectionExpression vectorpET-28a(+) (N-terminal His-tag)pMAL-c5X (MBP fusion)Fusion tags enhance solubility
Host StrainE. coli strainBL21(DE3)Arctic Express, Rosetta(DE3)Strain selection based on codon usage
Culture MediumMedium type2× YTAuto-induction medium, TBRich media improve yields
Growth PhaseOD₆₀₀ at induction0.6-0.80.4-0.6 (early log phase)Critical for protein folding
InductionIPTG concentration0.2 mM0.1 mM (for improved solubility)Lower concentrations reduce inclusion bodies
ExpressionTemperature18°C25°C (compromise temp)Lower temps enhance solubility
ExpressionDuration16-18 hours4-6 hours (higher temp)Extended time at low temp improves yield
Cell LysisBuffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerolAdd 0.5% Triton X-100 for improved extractionInclude protease inhibitors
PurificationPrimary methodNi-NTA affinity chromatographyAmylose resin (for MBP fusion)Optimize imidazole concentrations
PurificationSecondary methodSize exclusion chromatographyIon exchange chromatographyCritical for removing aggregates
StorageBuffer25 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTTPBS with 10% glycerolFlash freeze in liquid nitrogen

Relative expression of uspB under various stress conditions compared to standard growth conditions

Stress ConditionTranscript Level (Fold Change)*Protein Level (Fold Change)*Time to Maximum ExpressionNotable Cellular Responses
Oxidative stress (1 mM H₂O₂)+3.2 to +4.5+2.8 to +3.530-60 minutesIncreased catalase activity
Osmotic stress (0.5 M NaCl)+2.1 to +3.0+1.8 to +2.560-90 minutesCompatible solute accumulation
Acid stress (pH 5.0)+2.5 to +3.2+2.0 to +2.845-75 minutesAcid resistance proteins induced
Nutrient limitation+4.0 to +5.5+3.5 to +4.2120-180 minutesStringent response activation
Heat shock (42°C)+1.8 to +2.5+1.5 to +2.015-30 minutesChaperone induction
Cold shock (4°C)+2.0 to +3.0+1.8 to +2.660-120 minutesRNA helicase induction
Plant extract exposure+2.8 to +3.8+2.5 to +3.245-90 minutesVirulence gene upregulation
In planta growth+3.5 to +10.0+3.0 to +8.58-16 hoursCoordinated with virulence factors

*Fold change ranges represent expected values based on typical stress responses in related bacterial systems. Exact values would require experimental determination in P. carotovorum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.