Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0114 protein PC1_0431 (PC1_0431)

What is PC1_0431 and what are its basic characteristics?

PC1_0431 is a UPF0114 family protein from Pectobacterium carotovorum subsp. carotovorum, consisting of 168 amino acids. The full amino acid sequence is: MERFIENLMYTSRWLLAPVYLGLSLGLLALAIKFFQEVFHVLPNIFDIAEADLVLVLLSLIDMTLVGGLLVMVMLSGYENFVSALDITDGREKLNWLGKMDSGSLKNKVAASIVAISSIHLLRVFMDARNIPDNKLMWYVIIHLTFVLSALVMGYLDRMSRYEKSKAA . It has a UniProt ID of C6DJS4 and is classified as part of the UPF0114 protein family, which contains proteins of unknown function. The theoretical molecular weight of recombinant His-tagged PC1_0431 is approximately 20 kDa, and it has predicted membrane-associated properties based on its hydrophobic regions .

Methodologically, researchers should begin characterization with bioinformatic analysis to identify conserved domains, potential transmembrane regions, and sequence homology with functionally characterized proteins. Secondary structure prediction tools can provide initial insights into potential functional regions prior to experimental validation.

How should recombinant PC1_0431 be expressed and purified for functional studies?

Recombinant PC1_0431 can be successfully expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . The optimal expression protocol involves:

• Cloning the PC1_0431 gene into an appropriate expression vector containing a His-tag sequence

• Transforming the construct into E. coli expression strains (BL21(DE3) or similar)

• Inducing expression using IPTG under controlled temperature conditions

• Lysing cells and purifying using Ni-NTA affinity chromatography

• Verifying purity through SDS-PAGE (>90% purity should be achievable)

For functional studies, researchers should consider removing the His-tag if it might interfere with protein function or interaction studies. Additionally, proper folding should be verified using circular dichroism spectroscopy, especially since PC1_0431 contains hydrophobic regions that may affect solubility.

What are the optimal storage conditions for maintaining PC1_0431 stability?

Recombinant PC1_0431 should be stored as a lyophilized powder at -20°C to -80°C for long-term storage . For working solutions, researchers should follow these evidence-based protocols:

• Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (optimally 50%) to prevent freeze-thaw damage

• Aliquot the solution to minimize freeze-thaw cycles

• Store working aliquots at 4°C for up to one week

• Store long-term aliquots at -20°C or preferably -80°C

Notably, researchers should avoid repeated freeze-thaw cycles as they significantly compromise protein integrity. For buffer conditions, a Tris/PBS-based buffer at pH 8.0 containing 6% trehalose has been demonstrated to maintain stability . When planning experiments, researchers should perform stability testing at different time points to establish the functional half-life of the protein under their specific laboratory conditions.

What is currently known about the function of UPF0114 family proteins?

The UPF0114 protein family remains largely uncharacterized, presenting significant opportunities for novel research. Current evidence suggests these proteins may be involved in:

• Membrane-associated processes based on their hydrophobic profiles

• Potential roles in bacterial adaptation during host interactions

• Possible involvement in stress responses or environmental adaptation

While direct functional data for PC1_0431 is limited, studies on Pectobacterium carotovorum have identified differentially expressed proteins during plant infection, suggesting that UPF0114 family proteins may play roles in host-pathogen interactions . Protein P47 in the comprehensive proteomic analysis (gi|253687336) from P. carotovorum PC1 was identified as differentially expressed during infection, which could be related to UPF0114 family proteins .

For methodology, researchers should consider comparative genomics approaches, analyzing the conservation and genetic context of UPF0114 family genes across bacterial species to infer potential functions. Additionally, transcriptomic analysis during different growth conditions could reveal expression patterns that suggest functional roles.

What experimental design approaches are most appropriate for investigating PC1_0431's role in pathogenicity?

Based on established pathogenicity research methods, a comprehensive experimental design for investigating PC1_0431's role should incorporate:

• Gene knockout studies using homologous recombination or CRISPR-Cas

• Complementation assays to verify phenotypes

• Controlled infection assays with wildtype and mutant strains

• Quantitative assessment of virulence factors

Previous studies investigating Pectobacterium carotovorum proteins utilized a systematic approach combining in vitro and in vivo conditions to identify differentially expressed proteins during infection . Following this methodology:

Analysis should include quantitative assessments of plant cell wall-degrading enzymes (PCWDEs) such as pectate lyase (Pel), polygalacturonase (Peh), cellulase (Cel), and protease (Prt), which are established pathogenicity determinants in Pectobacterium . The experimental design should include appropriate controls and statistical analysis methods, with randomization of treatment groups and blinding of assessors when possible to minimize bias .

How can researchers effectively study the expression regulation of PC1_0431 during host infection?

To study PC1_0431 expression regulation during infection, researchers should employ a multi-technique approach:

• Transcriptomics: RNA-Seq or qRT-PCR analysis comparing expression levels in different growth conditions and during infection stages

• Promoter analysis: Reporter gene fusions (GFP, LUX) to the PC1_0431 promoter to monitor expression in real-time

• ChIP-Seq: Identification of transcription factors that bind to the PC1_0431 promoter

• Proteomics: Quantitative proteomics using techniques like 2D-DIGE or LC-MS/MS as used in previous Pectobacterium studies

The comparative approach between in vitro and in vivo conditions is crucial, as demonstrated in the study that identified 53 differentially expressed proteins in Pectobacterium during plant infection . This approach revealed proteins up-regulated specifically during in vivo conditions that were not identified using plant extracts in vitro, highlighting the importance of authentic infection environments for expression studies.

Researchers should design experiments with appropriate time-course sampling to capture expression changes throughout the infection process, from initial contact through colonization and active disease development. Statistical analysis should account for biological variability between infection events.

What structural and functional prediction methods would yield insights into PC1_0431's biochemical role?

A comprehensive structural and functional characterization would involve:

• Advanced bioinformatic analysis:

  • Hidden Markov Model (HMM) searches for remote homology detection

  • Protein family classification through InterPro and Pfam databases

  • Structural prediction using AlphaFold2 or RoseTTAFold

  • Molecular dynamics simulations to predict stable conformations

• Experimental structural determination:

  • X-ray crystallography or cryo-EM for high-resolution structure

  • NMR spectroscopy for dynamic regions analysis

  • Limited proteolysis to identify stable domains

  • Circular dichroism to determine secondary structure composition

• Functional prediction validation:

  • Site-directed mutagenesis of predicted functional residues

  • Protein-protein interaction studies using yeast two-hybrid or pull-down assays

  • Subcellular localization using fluorescent protein fusions

  • In vitro biochemical assays based on predicted activities

The amino acid sequence suggests PC1_0431 contains hydrophobic regions that could indicate membrane association or protein-protein interaction domains . Researchers should pay particular attention to the potential transmembrane regions and any conserved motifs shared with other UPF0114 family proteins when designing functional studies.

How does PC1_0431 compare with homologous proteins in other bacterial species?

Researchers investigating homology relationships should implement:

• Comprehensive sequence alignment using BLAST, FASTA, and HMM-based methods

• Phylogenetic analysis to determine evolutionary relationships

• Synteny analysis to examine conservation of genomic context

• Structural comparison of predicted or determined structures

Previous proteomic studies of Pectobacterium revealed protein homology with multiple bacterial species including P. atrosepticum SCRI1043 and Bradyrhizobium sp., highlighting the importance of cross-species comparisons . When analyzing homologs, researchers should construct a table similar to this:

Functional studies in multiple species can provide critical insights, especially if homologs exist in model organisms where genetic manipulation is well-established. Complementation studies across species boundaries can determine functional conservation.

What methodologies are optimal for investigating protein-protein interactions involving PC1_0431?

To investigate protein-protein interactions involving PC1_0431, researchers should employ multiple complementary techniques:

• In vitro methods:

  • Pull-down assays using His-tagged PC1_0431

  • Surface plasmon resonance for interaction kinetics

  • Isothermal titration calorimetry for thermodynamic parameters

  • Crosslinking mass spectrometry for interaction interfaces

• In vivo methods:

  • Bacterial two-hybrid or three-hybrid systems

  • Co-immunoprecipitation followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET)

  • Bimolecular fluorescence complementation (BiFC)

• Computational prediction:

  • Interface prediction algorithms

  • Molecular docking simulations

  • Coevolution analysis of sequence alignments

The approach should be tailored to the membrane-associated nature of PC1_0431, with appropriate detergents or membrane mimetics for solubilization. When identifying interaction partners, researchers should prioritize validation using multiple independent techniques and include appropriate negative controls to filter out common contaminants in affinity purification experiments.

What are the key research gaps and future directions for PC1_0431 studies?

Current knowledge gaps surrounding PC1_0431 present several key research opportunities:

• Functional characterization: The fundamental biological function of PC1_0431 and UPF0114 family proteins remains largely unknown, representing a primary research opportunity.

• Structural determination: High-resolution structural data would significantly advance understanding of function and guide rational experimental design.

• Expression regulation: Understanding how PC1_0431 expression responds to environmental conditions and host factors would provide insights into its biological context.

• Role in pathogenicity: Determining whether PC1_0431 contributes to virulence requires systematic investigation through gene knockout and phenotypic analysis.

• Interaction network: Identifying the protein interaction partners would place PC1_0431 in the broader cellular context of Pectobacterium biology.

Future research directions should employ interdisciplinary approaches combining genomics, proteomics, structural biology, and pathogenicity testing. The comparative approach between in vitro and in vivo conditions, as demonstrated in previous Pectobacterium studies , provides a powerful framework for understanding the authentic biological roles of PC1_0431 during host interaction.