Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0208 membrane protein PC1_2779 (PC1_2779)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PC1_2779; UPF0208 membrane protein PC1_2779
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
PC1_2779
Target Protein Sequence
MATKPDSRISWLQLLQRGQHYMKTWPAEKQLAPVFPENRVARATRFGIRIMPPLAVFTLT WQIALGGQLGPAIATALFACSLPLQGLWWLGRRSVTPLPPTLAQWFHEIRHKLLESGQAL APLEEAPTYQSLADVLKRAFSQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pectobacterium carotovorum subsp. carotovorum and why is it significant?

Pectobacterium carotovorum subsp. carotovorum (formerly known as Erwinia carotovora subsp. carotovora) is a plant pathogenic bacterium that causes soft rot and stem rot diseases in several economically important crops, including Chinese cabbage, potato, and tomato. The significance of this bacterium lies in its ability to produce plant cell wall-degrading enzymes that macerate plant tissues, leading to substantial crop losses worldwide. Understanding the molecular mechanisms of this pathogen is crucial for developing effective control strategies in agricultural settings. Recent research has focused on various biocontrol methods, including bacteriophage treatments, which have shown promise in reducing disease incidence .

What is the UPF0208 membrane protein PC1_2779?

The UPF0208 membrane protein PC1_2779 is a protein found in Pectobacterium carotovorum subsp. carotovorum (strain PC1). This protein belongs to the UPF0208 family of membrane proteins, which are typically characterized by their uncharacterized protein function (UPF) designation. PC1_2779 consists of 151 amino acids and has a sequence that suggests it is an integral membrane protein. The full amino acid sequence is: MATKPDSRISWLQLLQRGQHYMKTWPAEKQLAPVFPENRVARATRFGIRIMPPLAVFTLTWQIALGGQLGPAIATALFACSLPLQGLWWLGRRSVTPLPPTLAQWFHEIRHKLLESGQALAPLEEAPTYQSLADVLKRAFSQLDKTFLDDL .

What is the current state of knowledge regarding the function of PC1_2779?

The function of PC1_2779 remains largely uncharacterized, as indicated by its UPF (Uncharacterized Protein Family) designation. This represents a significant knowledge gap in our understanding of Pectobacterium carotovorum subsp. carotovorum biology. Given its membrane localization, it may be involved in transport functions, signaling, or maintaining membrane integrity. Methodological approaches to elucidate its function typically include comparative genomics, structure prediction algorithms, gene knockout studies, and protein-protein interaction analyses. Researchers investigating this protein should consider a multi-faceted approach combining computational predictions with experimental validation to generate hypotheses about its function.

What are the optimal conditions for expressing recombinant PC1_2779 protein?

The expression of recombinant PC1_2779 requires careful optimization of expression systems, considering the membrane-associated nature of this protein. Based on general practices for membrane protein expression:

  • Expression System Selection: E. coli BL21(DE3) or C43(DE3) strains are often suitable for membrane protein expression. Alternative systems like yeast (Pichia pastoris) may provide better folding for complex membrane proteins.

  • Vector Design: Include appropriate fusion tags (His-tag, GST, MBP) to facilitate purification and potentially enhance solubility. The specific tag type should be determined during the production process to optimize for protein stability and functionality .

  • Induction Conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve membrane protein folding. A typical protocol might use 0.1-0.5 mM IPTG induction at 18°C overnight.

  • Buffer Optimization: Incorporating mild detergents during cell lysis (e.g., n-dodecyl-β-D-maltoside or CHAPS) helps solubilize membrane proteins while maintaining native conformation.

The recombinant protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, with care taken to avoid repeated freeze-thaw cycles .

How should researchers design experiments to investigate PC1_2779 function?

When investigating the function of an uncharacterized membrane protein like PC1_2779, a systematic experimental design approach is essential:

Experimental ApproachKey TechniquesExpected OutcomesTimeframe
Bioinformatic AnalysisSequence alignment, structure prediction, phylogenetic analysisPutative function based on homology, predicted structure1-2 weeks
Localization StudiesGFP fusion, immunofluorescenceSubcellular localization, membrane topology1-2 months
Deletion Mutant AnalysisCRISPR-Cas9, homologous recombinationPhenotypic effects, growth characteristics2-3 months
Protein-Protein InteractionsCo-immunoprecipitation, bacterial two-hybrid, pull-down assaysInteraction partners3-4 months
Functional ComplementationGene complementation in mutant strainsRestoration of phenotype2-3 months

The experimental design should include randomization of samples to minimize bias and appropriate controls at each stage . For instance, when creating deletion mutants, include both positive controls (known genes with expected phenotypes) and negative controls (non-targeting constructs) to validate the specificity of observed effects. The experimental design should also account for potential confounding variables such as growth conditions, media composition, and bacterial strain backgrounds.

What purification methods are most effective for PC1_2779?

Purifying membrane proteins like PC1_2779 presents unique challenges that require specialized approaches:

  • Membrane Isolation: Begin with gentle cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations to identify optimal solubilization conditions that maintain protein stability and function.

  • Affinity Chromatography: Utilize the fusion tag (likely His-tag based on common practices) for initial purification via IMAC (Immobilized Metal Affinity Chromatography).

  • Size Exclusion Chromatography: Apply further purification using gel filtration to separate monomeric protein from aggregates and remove remaining contaminants.

  • Quality Assessment: Validate purity using SDS-PAGE, Western blotting, and mass spectrometry. Assess structural integrity using circular dichroism or limited proteolysis.

Researchers should monitor protein stability throughout the purification process, as membrane proteins are often prone to aggregation when removed from their native lipid environment. The final purified protein should be maintained in a buffer containing appropriate detergents or reconstituted into lipid nanodiscs or liposomes to preserve structural integrity.

How might PC1_2779 contribute to the virulence of Pectobacterium carotovorum?

While specific information about PC1_2779's role in virulence is not directly established in the available literature, several methodological approaches can be employed to investigate this question:

  • Comparative Expression Analysis: Quantify expression levels of PC1_2779 under various conditions mimicking host infection versus non-infection states using RT-qPCR or RNA-seq. Changes in expression during infection may suggest involvement in pathogenicity.

  • Virulence Assays with Mutant Strains: Generate PC1_2779 knockout or knockdown strains and assess their ability to cause disease symptoms in plant models compared to wild-type strains. Measure parameters such as lesion size, bacterial proliferation in planta, and production of virulence factors.

  • Host Response Analysis: Compare plant defense responses triggered by wild-type versus PC1_2779-deficient strains, examining transcriptomic and metabolomic changes in the host.

  • Protein Secretion Studies: Investigate whether PC1_2779 influences the secretion of known virulence factors such as plant cell wall-degrading enzymes, which are critical for the soft rot symptoms caused by Pectobacterium carotovorum .

Given that Pectobacterium carotovorum causes significant crop damage through soft rot disease, understanding the potential contribution of PC1_2779 to virulence could provide valuable insights for developing targeted disease control strategies.

What structural predictions can be made about PC1_2779 based on its amino acid sequence?

Based on the amino acid sequence of PC1_2779 (MATKPDSRISWLQLLQRGQHYMKTWPAEKQLAPVFPENRVARATRFGIRIMPPLAVFTLTWQIALGGQLGPAIATALFACSLPLQGLWWLGRRSVTPLPPTLAQWFHEIRHKLLESGQALAPLEEAPTYQSLADVLKRAFSQLDKTFLDDL) , several structural features can be predicted:

  • Transmembrane Domains: Hydrophobicity analysis would likely reveal 1-3 putative transmembrane helices, consistent with its classification as a membrane protein.

  • Secondary Structure: The sequence suggests a predominance of alpha-helical structures, particularly in hydrophobic regions that likely span the membrane.

  • Conserved Motifs: Comparison with other UPF0208 family members may reveal conserved amino acid patterns that could be functionally significant.

  • Post-translational Modification Sites: Analysis for potential phosphorylation, glycosylation, or lipidation sites may provide clues to regulatory mechanisms.

Researchers should employ multiple prediction algorithms (e.g., TMHMM, PSIPRED, I-TASSER) and compare their outputs to develop a consensus structural model. Experimental validation through techniques such as CD spectroscopy, limited proteolysis, or ideally X-ray crystallography or cryo-EM would be necessary to confirm these predictions. The structural information could guide the design of site-directed mutagenesis experiments targeting functionally important residues.

How does PC1_2779 compare to homologous proteins in other bacterial species?

A comprehensive homology analysis of PC1_2779 would involve:

  • Sequence Alignment: Perform BLAST searches against protein databases to identify homologs across bacterial species, with particular attention to other plant pathogens and related Enterobacteriaceae.

  • Phylogenetic Analysis: Construct phylogenetic trees to visualize evolutionary relationships and potential functional divergence.

  • Conservation Analysis: Identify highly conserved residues or motifs that may be crucial for protein function.

  • Functional Comparison: Determine whether homologs in other species have known functions that might inform PC1_2779's role.

SpeciesProtein HomologSequence Identity (%)Known FunctionReference
E. coliYciB~30-40% (predicted)Cell wall biogenesisHypothetical
Dickeya spp.UPF0208~70-80% (predicted)UnknownHypothetical
Yersinia spp.Membrane protein~50-60% (predicted)UnknownHypothetical

Note: The exact identity percentages would require actual sequence alignment analysis and are presented here as hypothetical values based on typical conservation patterns within bacterial families.

Functional complementation experiments, where PC1_2779 is expressed in strains lacking homologous proteins, could provide evidence for functional conservation or divergence across species.

What are the major challenges in studying membrane proteins like PC1_2779?

Membrane proteins present several unique challenges that researchers should anticipate when studying PC1_2779:

  • Protein Expression: Overexpression often leads to toxicity, misfolding, or inclusion body formation.

    • Solution: Utilize specialized expression strains (C41/C43), lower induction temperatures, and controlled expression systems.

  • Protein Solubilization: Extracting membrane proteins while maintaining native conformation is difficult.

    • Solution: Screen multiple detergents systematically; consider native nanodiscs or amphipols as alternatives to conventional detergents.

  • Stability Issues: Membrane proteins frequently aggregate or denature when removed from the lipid bilayer.

    • Solution: Include stabilizing agents (glycerol, specific lipids) in buffers; minimize protein manipulation steps and storage time .

  • Structural Analysis: Traditional structural biology techniques are challenging to apply to membrane proteins.

    • Solution: Consider emerging techniques like single-particle cryo-EM or solid-state NMR that may be more amenable to membrane protein analysis.

  • Functional Assays: Assessing function outside the native membrane environment is problematic.

    • Solution: Develop reconstituted systems (proteoliposomes, planar bilayers) that mimic native conditions for functional studies.

When designing experiments, researchers should build in additional time and resources to address these challenges, particularly at the protein production and purification stages.

How can researchers overcome the limitations of working with phytopathogenic bacteria in laboratory settings?

Working with plant pathogens like Pectobacterium carotovorum presents specific challenges:

  • Growth Conditions: Optimizing conditions that both support bacterial growth and mimic plant infection environments.

    • Solution: Develop defined media that simulate apoplastic fluid composition; utilize plant tissue extracts as growth supplements.

  • Genetic Manipulation: Some phytopathogens are less amenable to standard genetic techniques.

    • Solution: Adapt protocols specifically for Pectobacterium, utilizing specialized electroporation conditions or conjugation-based methods for DNA transfer.

  • In Planta Studies: Replicating natural infection processes in controlled settings.

    • Solution: Establish standardized plant infection models with defined inoculation protocols and quantitative disease assessment methods.

  • Biosafety Considerations: Preventing accidental release of plant pathogens.

    • Solution: Implement appropriate containment measures; consider using attenuated strains for certain experiments.

  • Variability in Virulence: Maintaining consistent virulence phenotypes in lab cultures.

    • Solution: Regular passage through plants or storage in conditions that preserve virulence factors; molecular verification of virulence gene presence.

The study of bacteriophage PP1, which specifically targets Pectobacterium carotovorum, demonstrates successful laboratory cultivation and experimental manipulation of this bacterium, suggesting established protocols exist for overcoming these challenges .

What controls should be included when studying the function of PC1_2779?

Rigorous experimental design for investigating PC1_2779 function should include the following controls:

  • Genetic Controls:

    • Wild-type strain (positive control)

    • Empty vector transformants (negative control for complementation studies)

    • Deletion/mutation of known genes with similar predicted functions (comparative control)

    • Deletion/mutation of unrelated genes (specificity control)

  • Expression Controls:

    • Western blot confirmation of protein expression

    • GFP-fusion localization verification

    • Expression of unrelated membrane proteins (specificity control)

    • Quantitative PCR to confirm transcriptional changes

  • Functional Assays:

    • Known membrane protein inhibitors/activators (pharmacological controls)

    • Environmental controls (pH, temperature, osmolarity)

    • Time-course analyses to establish causality

    • Dose-dependent responses where applicable

  • Phenotypic Analysis:

    • Multiple independent mutant lines to confirm phenotypes

    • Complementation with wild-type gene to rescue phenotypes

    • Heterologous expression in related bacterial species

The experimental design should incorporate randomization to minimize bias and include sufficient biological and technical replicates to ensure statistical robustness . All experimental parameters should be systematically documented to facilitate reproducibility, including growth media composition, incubation conditions, and analytical methods.

How can systems biology approaches enhance our understanding of PC1_2779 function?

Systems biology offers powerful approaches to contextualize the function of PC1_2779 within the broader cellular network:

  • Multi-omics Integration: Combine transcriptomics, proteomics, and metabolomics data from wild-type and PC1_2779 mutant strains to identify affected pathways. This holistic view may reveal functional associations not apparent from single-approach studies.

  • Network Analysis: Construct protein-protein interaction networks and gene co-expression networks to predict functional associations of PC1_2779. Topological analysis of these networks can identify hub proteins and modules that include PC1_2779.

  • Flux Balance Analysis: Develop metabolic models incorporating PC1_2779 to predict its impact on cellular metabolism and identify essential pathways affected by its absence.

  • Comparative Systems Biology: Compare system-wide responses between Pectobacterium carotovorum and other bacteria with PC1_2779 homologs to identify conserved functional patterns.

A methodological workflow might include:

  • Gene expression profiling (RNA-seq) of wild-type vs. mutant strains under various conditions

  • Quantitative proteomics to identify altered protein abundances and post-translational modifications

  • Metabolite profiling to detect changes in cellular metabolism

  • Integration of these datasets using computational tools to identify statistically significant patterns

  • Validation of key predictions using targeted experimental approaches

This multi-layered approach can provide a more comprehensive understanding of PC1_2779's role than isolated experiments alone.

What potential biotechnological applications might emerge from research on PC1_2779?

Research on bacterial membrane proteins like PC1_2779 could lead to several biotechnological applications:

  • Antimicrobial Development: If PC1_2779 proves essential for bacterial viability or virulence, it could represent a novel target for antimicrobial compounds specific to plant pathogens. This would be particularly valuable given the economic impact of soft rot diseases in agriculture.

  • Biosensor Development: Membrane proteins can be incorporated into biosensor platforms for detecting specific molecules. If PC1_2779 interacts with plant compounds or environmental signals, it might be adapted for biosensing applications.

  • Protein Engineering: Understanding the structure-function relationship of PC1_2779 could inform the design of engineered membrane proteins with novel properties, such as modified substrate specificity or improved stability.

  • Phage Therapy Enhancement: Knowledge about membrane proteins like PC1_2779 could complement bacteriophage-based biocontrol strategies. For instance, if PC1_2779 serves as a phage receptor, this information could be used to enhance phage binding specificity or overcome bacterial resistance mechanisms .

  • Agricultural Diagnostics: Antibodies or aptamers targeting PC1_2779 could be developed for rapid detection of Pectobacterium carotovorum in field samples, enabling early intervention before disease symptoms appear.

The development of these applications would require thorough characterization of PC1_2779 structure and function, followed by proof-of-concept studies demonstrating the feasibility of the proposed biotechnological use.

How might research on PC1_2779 contribute to understanding bacterial evolution and adaptation?

The study of membrane proteins like PC1_2779 can provide valuable insights into bacterial evolution and adaptation:

  • Evolutionary Conservation: Analysis of PC1_2779 homologs across bacterial species can reveal evolutionary pressures acting on this protein. Regions under positive selection might indicate adaptation to different hosts or environments, while highly conserved regions likely perform essential functions.

  • Horizontal Gene Transfer: Investigating the genomic context of PC1_2779 might reveal evidence of horizontal gene transfer events, potentially indicating acquisition of new functions during adaptation to plant hosts.

  • Host-Pathogen Co-evolution: Comparing PC1_2779 variants from Pectobacterium strains isolated from different plant hosts could illuminate co-evolutionary dynamics between pathogen membrane proteins and host recognition systems.

  • Environmental Adaptation: Studying how PC1_2779 structure or expression changes in response to different environmental conditions might provide insights into bacterial adaptation mechanisms.

Methodological approaches could include:

  • Comparative genomics across bacterial species with varying host ranges and environmental niches

  • Analysis of selection pressures using dN/dS ratios

  • Ancestral sequence reconstruction to trace the evolutionary history of PC1_2779

  • Experimental evolution studies to observe real-time adaptation of PC1_2779 under controlled selective pressures

This evolutionary perspective could not only enhance fundamental understanding of bacterial adaptation but also inform strategies for managing the emergence of more virulent or resistant pathogen strains.

What emerging technologies could accelerate research on proteins like PC1_2779?

Several cutting-edge technologies show promise for advancing research on membrane proteins like PC1_2779:

  • Cryo-Electron Microscopy: Recent advances in cryo-EM have revolutionized structural studies of membrane proteins, potentially allowing determination of PC1_2779 structure without crystallization.

  • AlphaFold and Deep Learning: AI-based structure prediction tools have dramatically improved accuracy for protein modeling, offering new insights into PC1_2779 structure-function relationships even before experimental structures are available.

  • CRISPR-Cas Systems: Adapted for bacterial genome editing, these systems enable precise genetic manipulation of Pectobacterium to study PC1_2779 function in vivo.

  • Single-Cell Techniques: Technologies like single-cell RNA-seq can reveal cell-to-cell variability in PC1_2779 expression and function during infection processes.

  • Native Mass Spectrometry: Advanced MS techniques allow analysis of intact membrane protein complexes, potentially revealing PC1_2779 interaction partners.

  • Microfluidics and Lab-on-a-Chip: These platforms enable high-throughput screening of conditions affecting PC1_2779 function or expression.

  • Synthetic Biology Tools: Designer membrane protein systems could allow functional reconstitution of PC1_2779 in controlled environments.

Researchers should consider integrating these emerging technologies into their experimental design to overcome traditional limitations in membrane protein research and accelerate discoveries related to PC1_2779.

What hypotheses about PC1_2779 warrant investigation based on current knowledge?

Based on the limited information available about PC1_2779 and broader knowledge of bacterial membrane proteins, several hypotheses merit investigation:

  • Transport Function Hypothesis: PC1_2779 may function as a transporter for specific molecules relevant to plant-pathogen interactions, such as plant metabolites, defense compounds, or bacterial virulence factors.

    • Testing Approach: Liposome reconstitution with purified protein followed by transport assays using radiolabeled substrates.

  • Virulence Regulation Hypothesis: PC1_2779 may serve as a sensor for environmental cues that trigger virulence gene expression.

    • Testing Approach: Transcriptome analysis comparing wild-type and PC1_2779 mutant responses to plant extracts or infection-mimicking conditions.

  • Cell Wall Integrity Hypothesis: Based on putative similarities to other UPF0208 family proteins, PC1_2779 might play a role in maintaining bacterial cell wall integrity during plant colonization.

    • Testing Approach: Assessment of cell wall properties and stress resistance in mutant strains.

  • Phage Receptor Hypothesis: PC1_2779 might serve as a receptor for bacteriophages like PP1, which specifically target Pectobacterium carotovorum .

    • Testing Approach: Phage binding assays with purified protein and phage resistance studies with PC1_2779 mutants.

  • Protein Complex Formation Hypothesis: PC1_2779 may function as part of a larger protein complex involved in bacterial-plant interactions.

    • Testing Approach: Co-immunoprecipitation followed by mass spectrometry to identify interaction partners.

These hypotheses provide starting points for systematic investigation of PC1_2779 function, with each requiring carefully designed experiments and appropriate controls.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.