Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0259 membrane protein PC1_1998 (PC1_1998)

Shipped with Ice Packs
In Stock

Description

Key Features

PropertyDescription
Gene NamePC1_1998
Protein FamilyUPF0259 (uncharacterized membrane proteins)
Domain ArchitecturePredicted transmembrane helices with cytoplasmic loops
Post-Translational ModificationsNone reported; lacks disulfide bonds or glycosylation sites
KEGG AnnotationNo KO (KEGG Orthology) assigned; classified as a protein of unknown function .

Functional studies remain limited, but homologs in related bacteria suggest roles in membrane integrity or stress response .

Expression System

Produced in E. coli via recombinant DNA technology with an N-terminal His-tag .

Purification Protocol

StepConditions
LysisTris/PBS-based buffer (pH 8.0) with lysozyme
ChromatographyNickel-affinity chromatography
Final FormLyophilized powder in Tris/PBS buffer with 6% trehalose
Purity>90% (SDS-PAGE verified)

Documented Uses

  • Membrane Protein Studies: Used to investigate lipid-protein interactions in nanodisc reconstitution systems .

  • Biocontrol Development: Potential target for bacteriophage-based therapies against soft rot diseases (e.g., phage PP1) .

  • Antigen Production: His-tagged form facilitates antibody generation for immunodetection assays .

Key Research Findings

  • Lipid Interaction: Membrane proteins like PC1_1998 induce mechanical stress on lipid bilayers, altering lipid packing states (observed via FTIR spectroscopy) .

  • Biotechnological Relevance: Despite functional ambiguity, its conserved structure makes it a candidate for synthetic biology applications .

Challenges and Future Directions

  • Functional Elucidation: No enzymatic or ligand-binding activity has been confirmed .

  • Structural Biology: High-resolution crystal or cryo-EM structures are needed to map transmembrane topology .

  • Pathogenicity Studies: Role in P. carotovorum virulence mechanisms remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please indicate your desired format in your order notes, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. For reconstitution, use deionized sterile water to achieve a protein concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a guideline.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing your requested tag.
Synonyms
PC1_1998; UPF0259 membrane protein PC1_1998
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
PC1_1998
Target Protein Sequence
MPITANTLYRDTMNFTRNQFISILMMSLLTAFITVILNHALSPSVDELRILSSSGSDLSS SVESGLMDLIQQMTPEQQTVLLKMSAAGTFAALVGNVLLTGGVLMLIQLVSDGHRTSALR AIGASTPFLLRLLFLILLCTLLIQLGMMLLVIPGVLLAIALSLSPVIVVTEKSGIFSAIK ASTKLAYGNLRATAPAIVMWLLAKIAILLVVSKLPISSPTVLGVVLNGLSNLISAILLIY LFRLYMLLRA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of Pectobacterium carotovorum UPF0259 membrane protein PC1_1998?

    The PC1_1998 protein is a membrane protein from Pectobacterium carotovorum subsp. carotovorum, consisting of 250 amino acids. Its amino acid sequence is: MPITANTLYRDTMNFTRNQFISILMMSLLTAFITVILNHALSPSVDELRILSSSGSDLSSSVESGLMDLIQQMTPEQQTVLLKMSAAGTFAALVGNVLLTGGVLMLIQLVSDGHRTSALRAIGASTPFLLRLLFLILLCTLLIQLGMMLLVIPGVLLAIALSLSPVIVVTEKSGIFSAIKASTKLAYGNLRATAPAIVMWLLAKIAILLVVSKLPISSPTVLGVVLNGLSNLISAILLIYLFRLYMLRA . The protein belongs to the UPF0259 family of membrane proteins, with predicted transmembrane domains suggesting integration into the bacterial membrane. While its specific function remains under investigation, structural analysis indicates it may play a role in membrane integrity or transport processes in this plant pathogen, which is known to cause soft rot and stem rot diseases in various crops .

  • What expression systems are most suitable for recombinant PC1_1998 production?

    Several expression systems can be used for recombinant PC1_1998 production, each with distinct advantages:

    Expression SystemAdvantagesConsiderationsTypical Yield
    E. coliHigh yield, rapid growth, cost-effectiveLimited post-translational modifications, potential inclusion body formation≥ 10 mg/L
    YeastHigher eukaryotic modifications, good yieldLonger production time, more complex media5-8 mg/L
    Insect cellsBetter folding of complex proteins, more post-translational modificationsMore expensive, time-consuming2-5 mg/L
    Mammalian cellsMost complete post-translational modificationsHighest cost, lowest yield0.5-2 mg/L

    E. coli is the most commonly used system for PC1_1998 expression, typically with an N-terminal His-tag to facilitate purification . For functional studies requiring proper folding and membrane integration, insect or mammalian expression systems may be preferable despite lower yields .

  • What are the recommended storage conditions for recombinant PC1_1998?

    For optimal stability and activity maintenance of recombinant PC1_1998, the following storage protocols are recommended:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • For reconstituted protein, add 5-50% glycerol (optimal: 50%) as a cryoprotectant

    • Aliquot the protein to avoid repeated freeze-thaw cycles, which can lead to degradation

    • For short-term use, working aliquots can be stored at 4°C for up to one week

    • Use Tris/PBS-based buffer at pH 8.0 containing 6% trehalose for reconstitution and storage

    • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    Proper storage and handling significantly impacts experimental reproducibility when working with membrane proteins like PC1_1998.

Experimental Design and Methodology

  • How can I optimize recombinant expression of soluble PC1_1998 in E. coli?

    Optimizing soluble expression of membrane proteins like PC1_1998 requires systematic evaluation of multiple parameters:

    1. Strain selection: BL21(DE3), C41(DE3), and C43(DE3) strains are engineered for membrane protein expression with reduced toxicity

    2. Expression temperature: Lower temperatures (16-25°C) often increase solubility by slowing protein synthesis and improving folding

    3. Induction conditions: Use multivariant experimental design to optimize:

      • IPTG concentration (typically 0.1-1.0 mM)

      • Cell density at induction (OD600 0.4-0.8)

      • Duration of induction (4-6 hours for optimal productivity)

    4. Media composition: Supplementation with glycerol (0.5-1%), sorbitol, or specific metal ions can enhance membrane protein folding

    5. Co-expression strategies: Consider co-expressing chaperones (GroEL/GroES, DnaK/DnaJ) to aid in proper folding

    6. Fusion tags: Beyond His-tag, consider fusion with solubility-enhancing partners like MBP, SUMO, or Thioredoxin

    A systematic experimental design approach using fractional factorial screening (2^8-4) can efficiently identify optimal conditions with minimal experiments, as demonstrated in similar recombinant protein expression studies .

  • What analytical techniques are most effective for characterizing recombinant PC1_1998?

    Multiple complementary techniques should be employed for comprehensive characterization:

    Analytical TechniqueInformation ProvidedKey Parameters
    SDS-PAGEPurity, molecular weight, initial aggregation assessment>90% purity standard for research applications
    Western BlotProtein identity confirmation, degradation assessmentAnti-His or specific antibodies
    Size-Exclusion Chromatography (SEC)Oligomeric state, protein-detergent complex (PDC) analysisMolecular weight, hydrodynamic radius
    Circular DichroismSecondary structure content, folding assessmentAlpha-helical content expected for membrane proteins
    Multi-Detector SECPDC composition, detergent:protein ratioRI, UV, light scattering detectors
    Mass SpectrometryExact mass, post-translational modificationsIntact mass and peptide mapping
    Dynamic Light ScatteringAggregation state, size distributionPolydispersity index <0.2 desired

    For membrane proteins like PC1_1998, multi-detector SEC is particularly valuable as it can determine both protein and detergent components of the PDC, providing insights into the proportion of protein (approximately 46%) versus detergent (approximately 54%) in the complex .

  • What approaches can be used to study the membrane topology of PC1_1998?

    Understanding the membrane topology of PC1_1998 requires specialized techniques to determine transmembrane segments and their orientation:

    1. Protease protection assays: High-pH treatment disrupts sealed membrane compartments without solubilizing the lipid bilayer, allowing proteases to access soluble domains

    2. Cysteine-scanning mutagenesis: Systematic replacement of residues with cysteine followed by accessibility studies using membrane-permeable and impermeable reagents

    3. Fluorescence-based approaches: Strategic placement of fluorescent probes to monitor accessibility and environment

    4. Computational prediction: Tools like TMHMM, HMMTOP, and PredictProtein can provide initial topology models based on the amino acid sequence

    5. Proteinase K digestion: Non-specific protease digestion coupled with mass spectrometry analysis of protected fragments can identify membrane-embedded regions

    6. Reporter fusion constructs: Fusion of reporter domains (GFP, PhoA) to truncated versions of PC1_1998 to determine orientation

    These approaches can be combined with multidimensional protein identification technology (MudPIT) for comprehensive proteomic analysis of both the membrane and soluble domains of PC1_1998 .

Data Analysis and Interpretation

  • How should I analyze and interpret contradictory experimental data in PC1_1998 research?

    When facing contradictory data in membrane protein research:

    1. Systematic evaluation: Analyze each experimental condition independently, focusing on differences in protocols, reagents, and analytical methods

    2. Confirmation bias assessment: Be aware that researchers with different expectations can interpret the same data differently based on preconceived notions

    3. Exploratory vs. confirmatory approaches: Distinguish between exploratory findings (hypothesis-generating) and confirmatory results (hypothesis-testing)

    4. Statistical robustness: Apply appropriate statistical tests to determine if contradictions are statistically significant or within experimental error margins

    5. Replication strategy: Design direct replication studies with predefined criteria for success; consider Bayesian hypothesis testing to quantify replication evidence

    6. Documentation of discrepancies: Maintain a decision log of all analytical choices and interpretations to ensure reproducibility

    7. Multivariate analysis: Employ multivariate methods to identify interactions between variables that might explain contradictions

    As noted by Alfred North Whitehead, "In formal logic, a contradiction is the signal of defeat, but in the evolution of real knowledge, it marks the first step in progress toward a victory" . Contradictions often lead to new insights when systematically investigated.

  • What methods are appropriate for analyzing protein-detergent complexes involving PC1_1998?

    Protein-detergent complexes (PDCs) require specialized analytical approaches:

    1. Multi-detector Size-Exclusion Chromatography: Combining refractive index (RI), ultraviolet (UV), light scattering (LS), and intrinsic viscosity (IV) detectors allows determination of:

      • PDC molecular weight (approximately 74.5 kDa for similar membrane proteins)

      • Detergent micelle size (approximately 62.5 kDa for DDM micelles)

      • Protein contribution to the PDC (approximately 46%)

      • Detergent contribution to the PDC (approximately 54%)

    2. Component Analysis: For n-dodecyl β-D-maltoside (DDM) detergent:

      • dn/dc value: 0.1608 ml/g

      • Extinction coefficient: 0.0044 (A280; 1mg/ml)

    3. Derived Chromatograms: Construction of component concentration plots showing:

      • Distribution of free detergent micelles

      • Protein-associated detergent

      • Hydrodynamic radius measurements

    For PC1_1998, which has a calculated molecular weight of approximately 33 kDa for the protein alone, the PDC would be expected to have a total molecular weight of approximately 70-80 kDa when solubilized in DDM, with the detergent contributing approximately 40-45 kDa to the complex .

  • How can I ensure consistency and reproducibility in PC1_1998 experimental protocols?

    Ensuring reproducibility in membrane protein research requires:

    1. Protocol standardization: Document detailed workflows including all variables:

      • Expression conditions (temperature, media, induction parameters)

      • Purification methods (buffer composition, column types)

      • Analytical procedures (instrument settings, sample preparation)

    2. Pre-registration of experiments: Define primary objectives, endpoints, and statistical analysis plans before conducting experiments

    3. Consistency checks: Implement the following verification points:

      • Study type (exploratory vs. confirmatory)

      • Primary objective alignment

      • Primary endpoint definition

      • Hypothesis formulation

      • Sample size calculation

    4. Decision logging: Maintain a continuous log of all methodological decisions and deviations

    5. Replicate classifications: Distinguish between technical replicates (same biological sample) and biological replicates (independent biological samples)

    6. Intra-rater reliability testing: Periodically reanalyze samples to assess consistency in data interpretation

    Studies of academic trials have shown that inconsistencies in reporting sample size calculations, hypothesis formulation, and primary endpoints are common sources of reproducibility issues .

Advanced Research Applications

  • How can recombinant PC1_1998 be used in structural biology studies?

    Advanced structural biology approaches for PC1_1998 include:

    1. X-ray Crystallography:

      • Requires highly purified, homogeneous, and stable protein preparations

      • Screening of multiple detergents and lipidic cubic phase conditions

      • Addition of stabilizing antibody fragments or nanobodies

    2. Cryo-Electron Microscopy (Cryo-EM):

      • Particularly valuable for membrane proteins resistant to crystallization

      • Sample preparation in detergent micelles, nanodiscs, or amphipols

      • Single-particle analysis for 3D reconstruction

    3. NMR Spectroscopy:

      • Solution NMR for smaller membrane proteins or domains

      • Solid-state NMR for full-length proteins in lipid environments

      • Requires isotopic labeling (15N, 13C, 2H)

    4. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

      • Provides insights into dynamics and solvent accessibility

      • Compatible with protein-detergent complexes

      • Can reveal conformational changes upon ligand binding

    5. Small-Angle X-ray Scattering (SAXS):

      • Provides low-resolution envelope of the protein-detergent complex

      • Useful for validating computational models

      • Compatible with solution samples

    Selection of the appropriate method depends on the specific research question, protein stability, and available resources. Multi-technique approaches often provide complementary structural information.

  • What are the applications of PC1_1998 in understanding bacterial pathogenicity mechanisms?

    Research on PC1_1998 can contribute to understanding Pectobacterium carotovorum pathogenicity:

    1. Virulence factor characterization: As a membrane protein, PC1_1998 may participate in host-pathogen interactions or secretion systems essential for virulence

    2. Biofilm formation studies: Membrane proteins often contribute to bacterial adhesion and biofilm development, which enhance pathogen persistence

    3. Antimicrobial resistance mechanisms: Membrane proteins frequently function in efflux systems that contribute to resistance

    4. Phage receptor identification: Bacteriophages like PP1 and P7_Pc, which infect Pectobacterium carotovorum, often use membrane proteins as receptors

    5. Comparative proteomics: Analyzing PC1_1998 homologs across different Pectobacterium strains can reveal evolutionary adaptations related to host specificity or virulence

    6. Host response triggers: Membrane proteins can be recognized by plant defense systems, potentially triggering immune responses

    Understanding PC1_1998's function could contribute to developing novel biocontrol strategies for soft rot disease, which causes significant economic losses in crops including Chinese cabbage, potato, and tomato .

  • How can PC1_1998 research contribute to biocontrol strategies for plant pathogens?

    Pectobacterium carotovorum is a significant plant pathogen causing soft rot and stem rot diseases in several crops. Research on PC1_1998 can support biocontrol development through:

    1. Bacteriophage targeting: If PC1_1998 serves as a phage receptor, it could be exploited for phage-based biocontrol. Bacteriophages like PP1 have demonstrated high specificity for P. carotovorum with significant disease reduction in treatments

    2. Vaccine development: Similar to the approach with pneumolysin (Ply) for Streptococcus pneumoniae, conserved membrane proteins could serve as targets for developing plant vaccines

    3. Inhibitor design: Structure-based design of small molecules targeting PC1_1998 function could lead to new antimicrobial agents

    4. Diagnostic tools: PC1_1998 could serve as a biomarker for rapid detection of Pectobacterium carotovorum in plant tissues

    5. Resistance breeding: Understanding PC1_1998 interactions with plant defense mechanisms could inform breeding programs for resistant crop varieties

    The bacteriophage P7_Pc, characterized as a myovirus with lytic activity against P. carotovorum, represents a promising biocontrol agent. It exhibits no genes related to lysogeny, toxin production, or antibiotic resistance, making it suitable for environmental applications .

Troubleshooting and Common Challenges

  • How can I address inclusion body formation during PC1_1998 expression?

    Inclusion bodies are a common challenge when expressing membrane proteins like PC1_1998:

    1. Prevention strategies:

      • Lower induction temperature (16-20°C)

      • Reduce inducer concentration (0.1-0.2 mM IPTG)

      • Use specialized expression strains (C41, C43, Lemo21)

      • Co-express molecular chaperones

      • Add solubility-enhancing additives (sorbitol, glycerol, arginine)

      • Use auto-induction media for gradual protein expression

    2. Solubilization approaches (if inclusion bodies still form):

      • Mild detergents (n-dodecyl β-D-maltoside) for native-like extraction

      • Denaturing agents (urea, guanidine HCl) followed by controlled refolding

      • On-column refolding during purification

    3. Refolding protocols:

      • Gradual dialysis to remove denaturants

      • Addition of mixed detergent-lipid micelles

      • Pulse refolding with redox pairs (oxidized/reduced glutathione)

    4. Fusion tag strategies:

      • MBP (maltose-binding protein) tag for enhanced solubility

      • SUMO tag for native-like folding

      • GST or Thioredoxin fusion for solubility enhancement

    Using a systematic experimental design approach with the variables mentioned above can help identify optimal conditions for reducing inclusion body formation while maintaining high expression levels .

  • What strategies can overcome low yield in recombinant PC1_1998 production?

    To address low yield issues in PC1_1998 production:

    1. Expression optimization:

      • Test multiple expression vectors with different promoters (T7, tac, araBAD)

      • Optimize codon usage for E. coli

      • Evaluate different signal sequences for membrane targeting

      • Screen multiple E. coli strains (BL21, Rosetta, Origami)

    2. Culture conditions:

      • Implement fed-batch cultivation for higher cell density

      • Optimize media composition (rich vs. minimal, supplements)

      • Monitor dissolved oxygen levels and maintain optimal aeration

      • Control pH throughout cultivation

    3. Induction parameters:

      • Determine optimal induction timing (typically mid-log phase)

      • Test various inducer concentrations

      • Evaluate induction duration (4-6 hours often optimal)

    4. Purification recovery:

      • Optimize detergent type and concentration for efficient extraction

      • Implement mild solubilization conditions to preserve native structure

      • Add stabilizing agents (glycerol, specific lipids) to purification buffers

      • Use affinity purification methods with optimized binding and elution conditions

    5. Scale-up considerations:

      • Account for oxygen transfer limitations in larger volumes

      • Adjust mixing parameters to prevent shear damage

      • Implement temperature control strategies for larger fermenters

    Through systematic multivariate optimization using design of experiments (DoE) approaches, yields of 250 mg/L of soluble membrane proteins have been achieved in optimized E. coli expression systems .

  • How do I troubleshoot protein degradation issues with PC1_1998?

    Membrane protein degradation can significantly impact experimental outcomes:

    1. Preventive measures:

      • Add protease inhibitors throughout purification (PMSF, EDTA, leupeptin)

      • Maintain low temperature (4°C) during all handling steps

      • Minimize purification duration

      • Add stabilizing agents (glycerol, specific lipids)

      • Avoid freeze-thaw cycles by preparing single-use aliquots

    2. Degradation analysis:

      • Western blotting with N- and C-terminal epitope tags to detect fragmentation patterns

      • Mass spectrometry to identify specific cleavage sites

      • Size-exclusion chromatography to monitor aggregation

      • SDS-PAGE with time-course sampling to track degradation rate

    3. Storage optimization:

      • Determine optimal buffer conditions (pH, ionic strength)

      • Test various cryoprotectants (trehalose, glycerol)

      • Evaluate lyophilization for long-term storage

      • Compare storage at different temperatures (-20°C vs. -80°C)

    4. Expression modifications:

      • Co-express inhibitors of specific proteases

      • Remove recognition sequences for common proteases

      • Express as fusion with stabilizing partners

    For PC1_1998, Tris/PBS-based buffer at pH 8.0 containing 6% trehalose and 50% glycerol provides good stability for long-term storage at -20°C or -80°C .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.