Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0442 protein PC1_3642 (PC1_3642)

What is UPF0442 protein PC1_3642 and what are its basic properties?

PC1_3642 is a full-length protein (156 amino acids) from Pectobacterium carotovorum subsp. carotovorum, classified as a member of the UPF0442 protein family. This protein has the UniProt ID C6DEZ3. The "UPF" designation indicates it belongs to a family of proteins with unknown function that has been identified through computational analysis but lacks experimental characterization of its biological role .

The protein contains several predicted transmembrane domains, as suggested by its amino acid sequence, which includes multiple hydrophobic regions characteristic of membrane-associated proteins. Understanding these structural elements is crucial for designing appropriate experimental conditions when working with this protein.

How is the recombinant form of PC1_3642 typically prepared?

The recombinant form of PC1_3642 is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. The expression construct contains the complete protein sequence (amino acids 1-156) fused to the tag .

For researchers planning expression experiments, it's important to note that:

• The protein is typically provided as a lyophilized powder after purification

• SDS-PAGE analysis typically confirms >90% purity

• The protein is stabilized in Tris/PBS-based buffer with 6% trehalose at pH 8.0

• Proper reconstitution typically involves deionized sterile water to reach 0.1-1.0 mg/mL concentration

What are the recommended storage and handling conditions for recombinant PC1_3642?

Based on established protocols for similar recombinant proteins and specific information for PC1_3642, researchers should adhere to the following storage and handling guidelines:

Researchers should centrifuge the vial briefly before opening to ensure contents are at the bottom. After reconstitution, adding glycerol (typically to 50% final concentration) and creating working aliquots is recommended to prevent protein degradation from repeated freeze-thaw cycles .

What experimental approaches can be used to study the function of this uncharacterized protein?

When investigating an uncharacterized protein like PC1_3642, researchers should employ a multi-faceted experimental design approach:

• Sequence-based analysis:

  • Perform comprehensive bioinformatic analysis to identify conserved domains

  • Conduct phylogenetic analysis to identify evolutionary relationships with characterized proteins

  • Use structural prediction software to generate hypothetical 3D models

• Localization studies:

  • Employ fluorescent tagging to determine subcellular localization

  • Use fractionation techniques to confirm membrane association predicted by the hydrophobic sequence elements

• Interaction studies:

  • Perform pull-down assays using the His-tagged protein

  • Conduct bacterial two-hybrid screens to identify binding partners

  • Employ co-immunoprecipitation followed by mass spectrometry

• Functional assays:

  • Generate gene deletion mutants in Pectobacterium carotovorum

  • Conduct complementation studies with the recombinant protein

  • Perform phenotypic characterization of mutants vs. wild-type

Each approach should be designed with appropriate controls to ensure reliable interpretation of the results and should follow the experimental design principles outlined in scientific research .

What analytical methods are recommended for characterizing PC1_3642 structure?

For structural characterization of PC1_3642, researchers should consider a sequential analytical approach:

• Primary structure confirmation:

  • Mass spectrometry to confirm molecular weight and post-translational modifications

  • N-terminal sequencing to verify the intact protein

  • Peptide mapping after proteolytic digestion

• Secondary structure analysis:

  • Circular dichroism (CD) spectroscopy to estimate α-helix and β-sheet content

  • Fourier-transform infrared spectroscopy (FTIR) as a complementary method

• Tertiary structure investigation:

  • X-ray crystallography (requiring successful crystallization)

  • Nuclear magnetic resonance (NMR) for smaller domains

  • Cryo-electron microscopy for membrane-associated contexts

• Conformational stability assessment:

  • Thermal shift assays to determine melting temperature

  • Chemical denaturation studies using intrinsic fluorescence

Each method provides complementary information, and results should be integrated to build a comprehensive structural model of the protein.

How can researchers investigate potential membrane association of PC1_3642?

The amino acid sequence of PC1_3642 (MGLSLLWALLQDMALAAVPALGFAMVFNVPLKVLPYCALLGGVGHGVRFLAMHFGMNIEWASFLAAILIGIIGIRWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEAL MSVMITNFLKASFIVGALSIGLSLPGIWLYRKRPGV) contains multiple hydrophobic regions suggesting potential membrane association . To investigate this characteristic, researchers should employ a systematic approach:

• Computational prediction:

  • Use TMHMM, HMMTOP, or similar algorithms to predict transmembrane domains

  • Apply hydropathy plotting tools to visualize hydrophobic regions

  • Employ SignalP to identify potential signal sequences

• Experimental verification:

  • Perform membrane fractionation studies in native Pectobacterium or recombinant systems

  • Conduct protease protection assays to determine topology

  • Use fluorescence microscopy with GFP-fusion constructs to visualize localization

• Biophysical characterization:

  • Employ circular dichroism in the presence of membrane mimetics

  • Use differential scanning calorimetry to measure membrane interaction thermodynamics

  • Conduct tryptophan fluorescence studies to assess conformational changes upon membrane binding

This multi-method approach will provide robust evidence for or against membrane association and orientation.

What strategies can address challenges in crystallizing membrane-associated proteins like PC1_3642?

Crystallizing membrane-associated proteins presents unique challenges due to their hydrophobic surfaces. For PC1_3642, researchers should consider these specialized approaches:

• Construct optimization:

  • Design multiple constructs with varying boundaries to remove flexible regions

  • Create fusion proteins with crystallization chaperones (e.g., T4 lysozyme)

  • Consider removing the His-tag after purification if it introduces flexibility

• Detergent screening:

  • Systematically test multiple detergent types (nonionic, zwitterionic, etc.)

  • Employ small-scale thermal stability assays to identify optimal detergent conditions

  • Consider novel amphiphiles like maltose-neopentyl glycol (MNG) compounds

• Crystallization techniques:

  • Apply lipidic cubic phase methodologies for membrane proteins

  • Screen with robotics to maximize condition coverage with minimal protein

  • Implement microseeding to improve crystal quality and reproducibility

• Alternative approaches:

  • Consider Cryo-EM for structure determination if crystallization proves challenging

  • Employ SAXS to obtain low-resolution envelopes in solution

  • Use NMR for structural analysis of specific domains

The success rates for membrane protein crystallization remain lower than for soluble proteins, requiring persistence and methodical optimization of conditions.

How can researchers design experiments to identify potential binding partners of PC1_3642?

Identifying interaction partners is crucial for understanding the function of uncharacterized proteins like PC1_3642. A comprehensive experimental design should include:

• Affinity-based approaches:

  • Perform His-tag pull-downs followed by mass spectrometry

  • Conduct cross-linking studies to capture transient interactions

  • Employ bacterial two-hybrid or yeast two-hybrid systems with appropriate controls

• Proximity-based methods:

  • Utilize BioID or APEX2 proximity labeling in the native bacterial system

  • Implement FRET-based interaction assays for candidate partners

  • Apply co-immunoprecipitation with antibodies against the target protein

• Computational prediction and validation:

  • Use protein-protein interaction prediction algorithms

  • Perform molecular docking with candidate partners

  • Validate high-confidence predictions with targeted biochemical assays

• Functional validation:

  • Design mutagenesis experiments to disrupt predicted interfaces

  • Conduct competition assays with peptides derived from interaction interfaces

  • Perform functional assays to determine the biological significance of identified interactions

This integrated approach combines unbiased screening with targeted validation to identify physiologically relevant protein partners.

How should researchers interpret contradictory results when studying PC1_3642 activity?

When facing contradictory results in PC1_3642 research, employ a systematic troubleshooting approach:

• Experimental conditions assessment:

  • Evaluate buffer composition effects (pH, salt concentration, additives)

  • Test temperature-dependent activity profiles

  • Examine the impact of protein concentration on aggregation state

• Sample quality verification:

  • Confirm protein integrity by SDS-PAGE before each experiment

  • Verify activity using established controls where possible

  • Assess batch-to-batch variation with standardized assays

• Methodological validation:

  • Implement multiple orthogonal techniques to measure the same parameter

  • Conduct statistical analysis to determine significance of differences

  • Consider blinded experimental design to reduce experimenter bias

• Biological context considerations:

  • Investigate how results might differ between in vitro and in vivo conditions

  • Consider post-translational modifications that might affect activity

  • Examine species-specific differences if comparing across organisms

Rigorous application of these principles will help distinguish true biological phenomena from experimental artifacts.

What bioinformatic approaches are most effective for predicting PC1_3642 function?

When the experimental characterization of PC1_3642 is limited, bioinformatic approaches can guide hypothesis development:

• Sequence-based analysis:

  • Perform position-specific iterative BLAST (PSI-BLAST) to identify distant homologs

  • Use HMMER to search for conserved domains and motifs

  • Apply multiple sequence alignment to identify conserved residues across species

• Structural prediction:

  • Generate 3D models using AlphaFold2 or RoseTTAFold

  • Identify potential ligand-binding pockets using CASTp or similar tools

  • Compare predicted structures with characterized proteins using Dali or VAST

• Genomic context analysis:

  • Examine the organization of genes surrounding pc1_3642 in the genome

  • Identify potential operons or co-regulated genes

  • Perform phylogenetic profiling to find co-occurring genes across species

• Integrated approaches:

  • Combine results from multiple prediction methods

  • Weight predictions based on confidence scores from each method

  • Develop testable hypotheses based on the highest-confidence predictions

These computational approaches should guide experimental design rather than replace it, providing a framework for targeted functional studies.

What controls should be included when characterizing recombinant PC1_3642 activity?

Proper experimental controls are essential for reliable characterization of PC1_3642:

• Protein quality controls:

  • Include denatured protein samples to establish baseline for activity assays

  • Use site-directed mutants of predicted catalytic residues

  • Prepare tag-only controls to distinguish tag artifacts from protein-specific effects

• Experimental condition controls:

  • Include buffer-only controls in all assays

  • Perform time-course studies to ensure measurements within linear range

  • Test multiple protein concentrations to identify concentration-dependent effects

• Positive and negative controls:

  • Include well-characterized proteins from the same family when possible

  • Use unrelated proteins of similar size and properties as negative controls

  • Implement internal standards appropriate for each analytical method

• Validation controls:

  • Repeat critical experiments with independent protein preparations

  • Verify key findings using alternative methodological approaches

  • Consider blind sample coding for subjective measurements

Thorough implementation of these controls enhances data reliability and facilitates proper interpretation of results.

What experimental design would be most appropriate for studying PC1_3642 in its native context?

To study PC1_3642 in its native bacterial context, researchers should implement a multi-level experimental design:

• Genetic manipulation approaches:

  • Generate clean deletion mutants using allelic exchange

  • Create conditional expression systems for essential genes

  • Develop complementation strains with wild-type and mutant variants

• Expression analysis:

  • Perform quantitative RT-PCR to measure transcript levels

  • Use reporter gene fusions to study promoter activity

  • Implement RNA-seq to identify co-regulated genes

• Functional phenotyping:

  • Conduct comprehensive growth curve analysis under various conditions

  • Test virulence in appropriate plant host models

  • Perform metabolomic profiling to identify affected pathways

• Proteomic investigation:

  • Implement targeted proteomics to measure PC1_3642 levels

  • Conduct comparative proteomics between wild-type and mutant strains

  • Use protein complexome profiling to identify native protein complexes

This multi-faceted approach follows established principles for bacterial genetics and functional genomics, applying techniques from one-shot case studies to more complex pretest-posttest experimental designs .