Recombinant Pectobacterium carotovorum subsp. carotovorum Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
zntB; PC1_2318; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
zntB
Target Protein Sequence
MESFAGKELQHSGAVHAYQLDGKGGITPIGEQDVVNSEKPCWLHLDSTLPASARWLNKTT LVPDSVRNALAGESIRPRVTRLGDGTLITLRSINLNANARPDQLVAVRVFITDKLIISTR RRKVLAIDEILTDLKEGNGPTDSGSWLVSIAESLTDHTSEFIDDLHEKIIDLEDDLLEQK IPPRGELALIRKQLIVLRRYMTPQRDVFSRISGEKLPWMQDDDRRRMQEIADRLGRGLED LDASIARTTVLSDEITALMTEAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGGDAP FGFFTFCLMLVILVGGVAWWLKRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of ZntB in Pectobacterium carotovorum subsp. carotovorum?

The zinc transport protein ZntB plays a crucial role in zinc homeostasis in Pectobacterium carotovorum, a gram-negative, rod-shaped, non-sporulating facultatively anaerobic bacterium that causes Bacterial Soft Rot (BSR) in various crops and ornamentals . As an opportunistic pathogen, P. carotovorum requires specific environmental conditions for infection, and proper zinc homeostasis is essential for bacterial survival and virulence. ZntB facilitates zinc efflux, protecting the bacterium from zinc toxicity while ensuring sufficient intracellular zinc for metalloenzymes and regulatory proteins.

The proper regulation of metal ion concentrations, including zinc, is particularly important during the infection process, as bacterial pathogens frequently encounter metal limitation as part of host defense mechanisms. ZntB may be part of the bacterial adaptive response to varying zinc levels encountered during plant colonization. Like other bacterial zinc transporters, ZntB likely contributes to the bacterium's ability to establish infection and overcome host defenses.

How does ZntB fit into the broader context of bacterial zinc transport systems?

ZntB belongs to the broader family of zinc transporters that regulate cellular zinc balance and subcellular zinc distribution . Bacterial zinc transport systems typically fall into two complementary families: the ZnT (zinc efflux) and ZIP (zinc import) transporters. ZntB is part of a specifically evolved bacterial transport system that helps maintain zinc homeostasis.

The structural architecture of zinc transporters typically involves multiple transmembrane helices forming a transport channel. Based on comparative analysis with other zinc transporters, ZntB likely contains a conserved tetrahedral transport site with specific metal-coordinating residues that determine ion selectivity . This tetrahedral configuration typically includes amino acid residues that coordinate zinc ions during transport.

Zinc Transporter FamilyDirection of TransportTypical StructureCommon Coordinating Residues
ZnT (CDF family)Efflux (out of cytoplasm)6-8 transmembrane domainsHDHD or DDHD motif
ZIP familyUptake (into cytoplasm)8 transmembrane domainsBinuclear metal center with M1 and M2 sites
ZntB (CorA family)EffluxPentameric assemblyConserved GMN motif

What are the key structural features of ZntB that enable its function in zinc transport?

Based on structural analysis of related zinc transporters, ZntB likely contains multiple transmembrane helices that form a selective channel for zinc transport . The protein is expected to have a conserved tetrahedral transport site with specific coordinating residues that determine zinc selectivity over other divalent metals.

The metal binding site in zinc transporters typically involves histidine, aspartate, and occasionally glutamate residues that coordinate the zinc ion. These residues create a selective environment that preferentially binds zinc over other divalent metals. The selectivity filter is particularly important for distinguishing between zinc and cadmium, which have similar chemical properties but different biological effects.

The tetrahedral coordination geometry of the transport site is highly conserved across zinc transporters, and alterations to the coordinating residues can significantly impact transport function and metal selectivity . For instance, in related transporters, a single H-to-D substitution can alter the thermodynamic barrier to cadmium binding, conferring refined zinc selectivity.

What are the most effective methods for expressing and purifying recombinant ZntB from Pectobacterium carotovorum?

For effective expression and purification of recombinant ZntB, researchers should consider the following methodological approach:

Expression System Selection:

  • E. coli BL21(DE3) or equivalent strain is recommended for high-level expression

  • Consider codon optimization for P. carotovorum genes if expression levels are low

  • Test both N-terminal and C-terminal affinity tags to determine optimal configuration

  • Evaluate inducible promoter systems (T7, tac) with varying IPTG concentrations (0.1-1.0 mM)

Optimal Expression Conditions:

  • Temperature: Test expression at 16°C, 25°C, and 37°C (lower temperatures often improve folding)

  • Induction duration: Compare 4-hour and overnight induction periods

  • Media supplementation: Include 0.1-0.5 mM ZnSO₄ to ensure proper metal incorporation

Purification Strategy:

  • Affinity chromatography using His-tag or Strep-tag

  • Size exclusion chromatography to obtain homogeneous protein

  • Ion exchange chromatography for further purification if needed

Buffer Optimization:

  • Include mild detergents (0.03-0.05% DDM or LMNG) to stabilize the membrane protein

  • Maintain 50-100 μM ZnSO₄ in buffers to prevent metal loss

  • Test pH range 7.0-8.0 and various salt concentrations (100-300 mM NaCl)

This approach ensures proper folding and stability of the recombinant protein while maintaining its functional integrity for subsequent structural and functional studies.

How can researchers effectively design gene knockout experiments to determine the role of ZntB in P. carotovorum virulence?

When designing gene knockout experiments to assess ZntB's role in virulence, researchers should implement a comprehensive approach:

Knockout Strategy Design:

  • Use allelic exchange methods for clean deletion without polar effects

  • Consider CRISPR-Cas9 approaches for precise targeting

  • Create both full gene deletions and site-directed mutations of key residues

  • Develop complementation constructs under native promoter control

Essential Controls:

  • Wild-type P. carotovorum strain

  • Complemented mutant strain (restored zntB expression)

  • Control knockouts of known virulence factors

  • Growth rate measurements in standard media to detect general fitness defects

Phenotypic Analysis Pipeline:

  • In vitro growth curves under varying zinc concentrations (zinc-limited to zinc-excess)

  • Plant infection assays using appropriate host plants (e.g., Zantedeschia elliotiana)

  • Quantitative assessment of tissue maceration and bacterial population dynamics

  • Analysis of gene expression changes in zinc homeostasis networks

Following a similar approach to that used for other P. carotovorum virulence factors , researchers should monitor bacterial populations in planta at multiple time points post-infection (e.g., 8, 16, 24 hours after inoculation). This allows correlation between bacterial growth, symptom development, and the impact of the zntB deletion.

Data Analysis Framework:

  • Statistical comparison of disease progression between wild-type and mutant strains

  • Quantification of bacterial populations in planta over time

  • Correlation analysis between zinc transport capacity and virulence metrics

  • Transcriptomic analysis to identify compensatory mechanisms in knockout strains

What techniques should be employed to measure zinc transport activity of recombinant ZntB in vitro?

To effectively measure the zinc transport activity of recombinant ZntB, researchers should employ multiple complementary techniques:

Liposome-Based Transport Assays:

  • Reconstitute purified ZntB into proteoliposomes

  • Establish a zinc gradient across the membrane

  • Monitor zinc transport using zinc-sensitive fluorescent probes (FluoZin-3)

  • Analyze transport kinetics under varying conditions (pH, temperature, competing ions)

Isothermal Titration Calorimetry (ITC):

  • Determine binding affinity (Kd) for zinc and other divalent metals

  • Quantify thermodynamic parameters (ΔH, ΔS, ΔG)

  • Assess proton coupling during metal binding

  • Compare wild-type and mutant protein binding properties

Zinc-65 Radioisotope Transport Studies:

  • Directly measure zinc movement using radiolabeled ⁶⁵Zn

  • Calculate transport rates under varying conditions

  • Determine substrate specificity by competition assays

  • Assess the effects of inhibitors on transport activity

Microscale Thermophoresis (MST):

  • Evaluate binding affinities for various metal ions

  • Compare competitive binding between zinc and other metals

  • Assess the impact of point mutations on binding characteristics

  • Determine concentration-dependent binding parameters

When analyzing transport kinetics, researchers should generate Michaelis-Menten plots to determine Km and Vmax values for zinc transport. Additionally, inhibition studies using other divalent cations can provide insights into the selectivity filter properties of ZntB.

How does ZntB expression change during different phases of P. carotovorum infection, and what methods can detect these changes?

To characterize ZntB expression dynamics during infection, researchers should implement a multi-faceted approach:

Temporal Expression Analysis:

  • Conduct time-course sampling of infected plant tissues (e.g., at 4, 8, 16, 24 hours post-infection)

  • Compare with in vitro growth under zinc-limited and zinc-replete conditions

  • Correlate expression changes with disease progression stages

  • Identify key transition points in the infection process

Methodological Approaches:

  • RT-qPCR Analysis: Design and validate primers specific for zntB and reference genes for accurate quantification of transcript levels.

  • Proteomics: Implement two-dimensional electrophoresis coupled with mass spectrometry to identify differentially expressed proteins, similar to approaches previously used for P. carotovorum .

  • Reporter Gene Fusions: Create transcriptional and translational fusions (zntB-gfp, zntB-lux) to monitor expression in real-time.

  • RNAseq Analysis: Compare transcriptome profiles between in vitro and in planta conditions to identify co-regulated genes.

Previous proteomics studies with P. carotovorum have successfully identified 53 differentially expressed proteins during infection . Similar approaches could be applied specifically to track ZntB expression alongside other zinc homeostasis proteins. When analyzing differential expression data, particular attention should be paid to the correlation between ZntB levels and other virulence factors.

Infection StageExpected ZntB ExpressionRecommended Analysis MethodKey Correlating Factors
Early (0-8h)Moderate upregulationRT-qPCR, Reporter assaysInitial colonization factors
Mid (8-16h)Maximum expressionProteomics, RNAseqPlant defense responses
Late (16-24h+)Variable (strain-dependent)All methodsTissue maceration enzymes

What is the relationship between ZntB function and the expression of virulence factors in P. carotovorum?

The relationship between ZntB function and virulence factor expression likely involves complex regulatory networks:

Regulatory Network Analysis:

  • Construct transposon or targeted mutagenesis libraries in zntB and related zinc homeostasis genes

  • Screen for altered virulence phenotypes in plant infection models

  • Identify regulatory elements in the zntB promoter region

  • Investigate potential cross-talk with known virulence regulators (KdgR, CRP)

Previous research has established that the cAMP receptor protein (CRP) regulates carocin synthesis in P. carotovorum . Similar regulatory mechanisms may influence ZntB expression. Additionally, deletion of genes like clpP, mreB, flgK, and eda has been shown to reduce virulence in P. carotovorum , and researchers should investigate potential regulatory relationships between these genes and zntB.

Virulence Factor Coordination:

  • Determine if zinc limitation triggers coordinated expression of ZntB and virulence factors

  • Investigate whether ZntB-mediated zinc homeostasis affects quorum sensing systems

  • Examine the role of zinc as a cofactor for key virulence-associated enzymes

  • Assess whether host zinc sequestration triggers virulence factor expression

Experimental Approaches:

  • Compare transcriptional profiles of wild-type and zntB mutant strains during infection

  • Analyze virulence factor production under controlled zinc concentrations

  • Investigate binding of transcriptional regulators to the zntB promoter region

  • Perform ChIP-seq to identify global regulatory networks involving zinc homeostasis

How do post-translational modifications affect ZntB function, and what techniques can identify these modifications?

Post-translational modifications (PTMs) may significantly impact ZntB function through several mechanisms:

Potential PTMs Affecting ZntB:

  • Phosphorylation of cytoplasmic domains altering transport kinetics

  • S-nitrosylation of cysteine residues affecting metal coordination

  • Acetylation influencing protein-protein interactions

  • Ubiquitination regulating protein turnover rates

Identification Methodologies:

  • Mass Spectrometry-Based Approaches:

    • Shotgun proteomics with enrichment for modified peptides

    • Targeted MS/MS for specific modifications

    • SILAC labeling to quantify modification stoichiometry

    • Top-down proteomics for intact protein analysis

  • Site-Directed Mutagenesis:

    • Systematic mutation of potential modification sites

    • Functional assays comparing wild-type and mutant proteins

    • Phosphomimetic mutations (S/T to D/E) to simulate constitutive phosphorylation

  • Modification-Specific Techniques:

    • Phos-tag gels for phosphorylation detection

    • Biotin-switch technique for S-nitrosylation

    • Acetylation-specific antibodies for western blotting

When analyzing MS data, researchers should pay particular attention to the following residues based on conservation patterns in zinc transporters:

Modification TypePotential Target ResiduesFunctional ImpactDetection Method
PhosphorylationSer/Thr in cytoplasmic loopsTransport regulationPhosphoproteomic MS, Phos-tag
S-nitrosylationConserved Cys residuesRedox sensingBiotin-switch, MS/MS
AcetylationLys in N/C-terminal domainsProtein stabilityAcetyl-Lys antibodies, MS
UbiquitinationLys residuesProtein turnoverUbiquitin remnant profiling

What are the common challenges in studying ZntB function, and how can researchers overcome them?

Researchers investigating ZntB face several technical challenges that require specific troubleshooting approaches:

Challenge 1: Protein Instability and Aggregation

  • Solution: Optimize buffer conditions with stabilizing agents (glycerol 5-10%, specific lipids, zinc supplementation)

  • Approach: Implement thermal shift assays to identify stabilizing conditions

  • Validation: Monitor protein monodispersity using dynamic light scattering

Challenge 2: Low Expression Yields

  • Solution: Test multiple expression systems (E. coli, P. pastoris) and fusion partners (MBP, SUMO)

  • Approach: Optimize codon usage for heterologous expression

  • Validation: Western blot analysis of expression levels under various conditions

Challenge 3: Functional Assay Sensitivity

  • Solution: Develop high-sensitivity zinc detection methods

  • Approach: Combine multiple detection techniques (fluorescence, radioisotopes)

  • Validation: Calibrate assays using known zinc transporter mutants

Challenge 4: In vivo Phenotype Detection

  • Solution: Use multiple plant hosts and infection conditions

  • Approach: Develop sensitive quantitative assays for subtle phenotypes

  • Validation: Compare results with known virulence factor mutants

Challenge 5: Metal Specificity Determination

  • Solution: Implement competitive binding assays with multiple metals

  • Approach: Use ITC and other binding assays with careful metal contamination control

  • Validation: Site-directed mutagenesis of predicted metal-coordinating residues

How can researchers design experiments to differentiate between direct and indirect effects of ZntB mutations on bacterial physiology?

Differentiating direct from indirect effects requires carefully designed experiments:

Complementation Analysis:

  • Create a suite of complementation constructs:

    • Wild-type zntB under native and inducible promoters

    • Point mutants affecting specific functions (e.g., metal coordination site)

    • Chimeric constructs with domains from related transporters

  • Assess the ability of each construct to restore wild-type phenotypes

Conditional Expression Systems:

  • Use tightly regulated inducible promoters to control ZntB expression levels

  • Create a zntB depletion strain for temporal analysis of phenotypes

  • Monitor primary (immediate) vs. secondary (delayed) effects following expression changes

Metal Supplementation Rescue:

  • Test whether zinc supplementation can rescue zntB mutant phenotypes

  • Examine the effects of chelators on wild-type and mutant strains

  • Determine if other metal transporters can compensate for ZntB deficiency

Omics Approaches:

  • Conduct time-course transcriptomics following zntB deletion or induction

  • Perform metabolomics to identify metabolic perturbations

  • Use proteomics to detect changes in protein expression networks

The integration of these approaches allows researchers to construct a causal network distinguishing primary effects (direct consequences of altered zinc transport) from secondary adaptations (compensatory responses to altered zinc homeostasis).

What statistical approaches are most appropriate for analyzing ZntB transport kinetics data and comparing mutant variants?

Proper statistical analysis of transport kinetics requires rigorous approaches:

Kinetic Parameter Determination:

  • Use non-linear regression to fit transport data to appropriate models:

    • Michaelis-Menten equation for simple transport kinetics

    • Hill equation when cooperative binding is suspected

    • Competitive inhibition models when testing metal specificity

  • Implement global fitting approaches when analyzing multiple datasets simultaneously

Comparative Analysis of Variants:

  • ANOVA with post-hoc tests for comparing multiple variants

  • Paired t-tests for direct comparisons between wild-type and specific mutants

  • Bootstrap analysis to estimate confidence intervals for kinetic parameters

Robust Statistical Practices:

  • Minimum of 3-5 biological replicates per experiment

  • Technical replicates to assess measurement variability

  • Blind analysis when possible to reduce bias

  • Appropriate controls in each experimental batch

Advanced Analytical Approaches:

  • Principal Component Analysis to identify patterns in multivariate data

  • Hierarchical clustering to group functionally similar mutants

  • Bayesian analysis for complex kinetic models with multiple parameters

When reporting statistical results, researchers should include:

  • Specific statistical tests used

  • P-values and confidence intervals

  • Effect sizes to quantify the magnitude of differences

  • Power analysis to justify sample sizes

How might structural biology approaches advance our understanding of ZntB function in P. carotovorum?

Structural biology offers powerful approaches to elucidate ZntB function:

Cryo-Electron Microscopy:

  • Determine high-resolution structure of ZntB in different conformational states

  • Visualize the transport channel and metal binding sites

  • Identify structural changes during the transport cycle

  • Analyze oligomeric assembly and protein-protein interactions

X-ray Crystallography:

  • Obtain atomic-resolution structures of the metal binding domains

  • Co-crystallize with zinc and other metals to determine binding specificity

  • Analyze the structural basis of ion selectivity

  • Identify potential sites for rational drug design

Integrative Structural Biology:

  • Combine solution NMR with other structural techniques

  • Implement hydrogen-deuterium exchange mass spectrometry to probe dynamics

  • Use small-angle X-ray scattering to analyze conformational ensembles

  • Apply molecular dynamics simulations to model transport mechanisms

Based on structural studies of related zinc transporters, the ZntB protein likely contains a core transport domain with multiple transmembrane helices . Structural analysis would reveal the specific architecture of the zinc transport pathway and the coordination chemistry of the metal binding sites, providing insights into transport mechanism and selectivity.

What potential applications could emerge from detailed understanding of ZntB function in agricultural disease management?

Understanding ZntB function could lead to novel agricultural applications:

Targeted Antimicrobial Development:

  • Design small-molecule inhibitors of ZntB to disrupt zinc homeostasis

  • Develop peptide inhibitors targeting critical ZntB domains

  • Create zinc ionophores that bypass ZntB-mediated regulation

  • Identify natural products that selectively inhibit bacterial zinc transport

Host Resistance Engineering:

  • Develop plant varieties with enhanced zinc sequestration mechanisms

  • Engineer crops to express ZntB inhibitors during infection

  • Identify plant zinc-binding proteins that could be overexpressed

  • Create synthetic antimicrobial peptides targeting bacterial zinc transporters

Diagnostic Applications:

  • Design sensors for early detection of P. carotovorum based on zinc transporter activity

  • Develop molecular diagnostics targeting zntB sequence variations

  • Create biosensors monitoring zinc flux during early infection stages

  • Implement rapid field tests for bacterial soft rot prediction

Biological Control Strategies:

  • Identify beneficial microorganisms that compete for zinc in the rhizosphere

  • Develop zinc-chelating compounds for preventative treatments

  • Engineer biocontrol agents expressing ZntB inhibitors

  • Create probiotic plant treatments that modify zinc availability

How might comparative genomics of ZntB across bacterial species provide insights into its evolution and specialized functions?

Comparative genomics approaches offer valuable insights into ZntB evolution:

Phylogenetic Analysis:

  • Construct comprehensive phylogenetic trees of ZntB homologs

  • Identify lineage-specific adaptations in plant pathogens

  • Analyze selection pressures on different protein domains

  • Determine horizontal gene transfer events affecting zinc transporter distribution

Structural Conservation Analysis:

  • Identify highly conserved residues critical for function

  • Map variable regions that may confer species-specific properties

  • Analyze co-evolution patterns with interacting proteins

  • Determine conservation of regulatory elements in promoter regions

Ecological Adaptations:

  • Compare ZntB sequences from bacteria in different ecological niches

  • Analyze zinc transport systems in related plant pathogens and saprophytes

  • Identify adaptations to different plant host environments

  • Determine correlations between zinc transporter variations and host range

Functional Diversification:

  • Analyze potential neofunctionalization events in ZntB evolution

  • Compare metal specificity across evolutionary lineages

  • Identify lineage-specific regulatory mechanisms

  • Determine co-evolution with other virulence factors

By integrating these comparative approaches, researchers can gain insights into how ZntB has evolved specialized functions in P. carotovorum and related pathogens, potentially identifying unique features that could be targeted for disease control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.