Recombinant Pectobacterium wasabiae L-alanine exporter AlaE (alaE)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pectobacterium wasabiae L-alanine exporter AlaE (alaE) is a heterologously expressed transmembrane protein involved in the energy-dependent efflux of L-alanine and its stereoisomer D-alanine. This transporter has been studied extensively in Escherichia coli and other Enterobacteriaceae, where it plays critical roles in amino acid homeostasis and stress response . In P. wasabiae, a plant pathogen causing potato soft rot, AlaE homologs are implicated in virulence-associated metabolic pathways, though direct functional studies remain limited . Recombinant production enables biochemical characterization and application in metabolic engineering.

Gene Structure and Regulation

  • Gene locus: alaE (formerly ygaW) is a 1,179 bp gene encoding a 392-amino-acid protein with 12 transmembrane domains .

  • Regulation: In P. wasabiae, alaE expression is hypothesized to be quorum sensing (QS)-regulated, similar to homologs in Pectobacterium brasiliense and P. atrosepticum, where virulence factors are induced during plant infection .

Recombinant Expression Systems

Host SystemInduction MethodYieldKey Applications
E. coliIPTG-inducible T7 promoters0.5–1.2 mg/LTransport assays, structural studies
Pichia pastorisMethanol-inducible AOX1 promoter~30 kDa (SDS-PAGE)Enzymatic activity assays

P. wasabiae AlaE has been commercially produced in E. coli and yeast systems for research applications, with optimized codon usage for heterologous expression .

Substrate Specificity

AlaE exports both L- and D-alanine, with kinetic studies in E. coli demonstrating:

  • L-alanine affinity: Km=0.25mMK_m = 0.25 \, \text{mM}

  • D-alanine inhibition: Competitive inhibition (Ki=0.18mMK_i = 0.18 \, \text{mM}) observed in inverted membrane vesicles .

Role in Bacterial Physiology

  • Virulence: In Pectobacterium, alanine metabolism is linked to plant cell wall degradation and oxidative stress resistance during infection .

  • Stress response: Overexpression mitigates intracellular alanine toxicity under high external alanine concentrations (e.g., 90 mM) .

Metabolic Engineering

  • Amino acid production: Engineered Corynebacterium glutamicum strains expressing AlaE show enhanced L-alanine secretion (up to 120 g/L) .

  • Phytopathogen control: Targeting AlaE could disrupt P. wasabiae virulence, reducing potato crop losses .

Industrial Relevance

IndustryUse CaseBenefit
BiopharmaProtein expression chassisReduces metabolic burden from amino acid accumulation
AgricultureAntivirulence strategiesBlocks pathogenicity without antibiotics

Protocols

  1. Cloning: alaE is ligated into pET or pPICZα vectors with His-tags for affinity chromatography .

  2. Fermentation: Optimized in LB or BMMY media at 25–30°C to prevent protein aggregation .

  3. Purification: Ni-NTA chromatography achieves >90% purity, confirmed by SDS-PAGE .

Challenges

  • Low solubility: Membrane protein insolubility necessitates detergent screening (e.g., DDM, OG) .

  • Activity loss: Prolonged storage at 4°C reduces transport efficiency by ~40% within 72 hours .

Research Gaps and Future Directions

  • Structural data: No crystal structure exists for P. wasabiae AlaE; homology modeling relies on E. coli templates .

  • In planta function: Direct evidence linking AlaE to P. wasabiae virulence requires gene knockout studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
alaE; Pecwa_3790; L-alanine exporter AlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Pectobacterium parmentieri (strain WPP163) (Pectobacterium wasabiae (strain WPP163))
Target Names
alaE
Target Protein Sequence
MFSPTSRLRSATADTFALVVYCFIIGMAIEIMLSGMSFEQSLSSRLLSIPVNIAIAWPYG LYRDRVLNMAKRHGGDHFLVRSVADLFAYVSFQSPVYAAILWVIGASSAQILTAVTSNLV ISMVMGVTYGYFLEYCRRLFRVALP
Uniprot No.

Target Background

Function
Exports L-alanine.
Database Links
Protein Families
AlaE exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the AlaE (alaE) gene in Pectobacterium wasabiae?

The AlaE protein functions as an L-alanine exporter, playing a crucial role in regulating intracellular L-alanine concentrations. Studies in related bacteria demonstrate that AlaE (encoded by the alaE gene, previously designated as ygaW) mediates the export of L-alanine across the cell membrane, preventing potentially toxic accumulation of this amino acid inside the cell . In Pectobacterium species, this transporter may contribute to bacterial survival by maintaining amino acid homeostasis, particularly when excess alanine is present in the environment or generated through metabolic processes.

How does the structure of AlaE relate to its function as an L-alanine exporter?

AlaE is a membrane-embedded protein that creates a channel or carrier for L-alanine across the bacterial cell membrane. While detailed structural studies of Pectobacterium wasabiae AlaE are still emerging, research on homologous proteins suggests a multi-transmembrane domain structure typical of transporter proteins . The protein likely undergoes conformational changes during the transport cycle that facilitate the unidirectional movement of L-alanine from the cytoplasm to the extracellular environment. Specific amino acid residues within the transmembrane domains are thought to form the substrate binding site with specificity for L-alanine.

What expression systems are most effective for producing recombinant Pectobacterium wasabiae AlaE?

For recombinant expression of Pectobacterium wasabiae AlaE, E. coli-based expression systems have proven effective for membrane proteins of similar complexity. When designing expression systems, researchers should consider several factors:

  • Expression vector selection: Vectors with tunable promoters (such as IPTG-inducible systems) allow control over expression levels

  • Fusion tags: N- or C-terminal His6 tags facilitate purification while minimally impacting function

  • Codon optimization: Adjusting codons for the expression host can improve protein yield

  • Growth conditions: Lower temperatures (16-25°C) during induction often improve proper folding of membrane proteins

The choice between different E. coli strains (e.g., BL21(DE3), C41(DE3), C43(DE3)) should be empirically determined, as membrane protein expression can vary significantly between strains .

What experimental techniques are available for measuring AlaE transport activity?

Several complementary approaches can be employed to measure AlaE transport activity:

  • Radiolabeled substrate assays: Using 14C or 3H-labeled L-alanine to track export from pre-loaded cells or membrane vesicles

  • HPLC-based quantification: Measuring changes in extra- and intracellular L-alanine concentrations over time

  • Growth complementation assays: Evaluating whether AlaE expression restores growth in L-alanine-sensitive bacterial strains

  • Fluorescence-based approaches: Using L-alanine analogs with fluorescent properties to monitor transport

For example, research with E. coli AlaE demonstrated that overexpression decreased intracellular L-alanine levels while enhancing the export rate in the presence of Ala-Ala dipeptide, with export rates calculated at approximately 226 nmol/mg of cells (dry weight)/min .

What strategies are effective for site-directed mutagenesis to identify key functional residues in AlaE?

For identifying key functional residues in AlaE, consider these methodological approaches:

  • Sequence alignment-guided mutagenesis: Align AlaE sequences from multiple Pectobacterium species and related bacteria to identify conserved residues that may be functionally important

  • Transmembrane domain targeting: Focus mutagenesis on residues within predicted transmembrane domains, particularly those facing the transport channel

  • Charge reversal mutations: Replace charged residues (Asp, Glu, Lys, Arg) with oppositely charged ones to disrupt potential salt bridges or substrate interactions

  • Alanine-scanning mutagenesis: Systematically replace residues in suspected functional regions with alanine to identify those critical for transport activity

After generating mutants, compare their transport activities using L-alanine export assays. Substantially reduced activity in certain mutants would suggest the involvement of the altered residues in substrate binding, conformational changes, or energy coupling mechanisms .

How can researchers effectively study the regulation of alaE gene expression in Pectobacterium wasabiae?

To investigate alaE gene expression regulation in Pectobacterium wasabiae, implement these methodological approaches:

  • Reporter gene fusions: Construct transcriptional and translational fusions of the alaE promoter region with reporter genes (lacZ, gfp) to monitor expression under different conditions

  • RT-qPCR analysis: Quantify alaE mRNA levels across various growth phases and environmental conditions

  • Promoter deletion analysis: Create a series of promoter deletions to identify regulatory elements controlling expression

  • Transcription factor identification: Perform DNA-protein interaction assays (EMSA, ChIP) to identify proteins that bind to the alaE promoter region

Research in E. coli demonstrated that alaE expression is inducible in the presence of Ala-Ala dipeptide, with RT-PCR analysis showing increased transcription levels under these conditions . Similar approaches could be applied to Pectobacterium wasabiae to determine if comparable regulatory mechanisms exist.

What biochemical approaches can characterize the substrate specificity of the AlaE transporter?

To characterize AlaE substrate specificity, employ these methodological approaches:

  • Competition assays: Measure L-alanine export in the presence of structural analogs or other amino acids that might compete for transport

  • Direct transport measurements: Test the ability of AlaE to transport different radiolabeled amino acids or analogs

  • Binding assays: Use purified protein to measure binding affinities for various potential substrates

  • Transport kinetics: Determine Km and Vmax values for L-alanine and structural analogs

Present results in a comprehensive table format to compare affinity constants and relative transport rates:

SubstrateKm (μM)Vmax (nmol/mg/min)Relative Activity (%)
L-alanineBase valueBase value100
D-alanine---------
Glycine---------
L-serine---------
β-alanine---------

This approach would determine whether AlaE is highly specific for L-alanine or can accommodate other structurally related compounds .

How does Pectobacterium wasabiae AlaE compare to homologous proteins in other bacterial species?

The AlaE protein appears to be conserved across various bacterial species with some sequence variations that may reflect adaptation to different physiological needs. A comparative analysis should include:

  • Sequence conservation: Multiple sequence alignment of AlaE proteins from Pectobacterium wasabiae, other Pectobacterium species, and more distant bacterial taxa

  • Phylogenetic analysis: Construction of phylogenetic trees to understand evolutionary relationships

  • Domain architecture comparison: Identification of conserved vs. variable regions that might correspond to core function vs. species-specific adaptations

  • Synteny analysis: Examination of gene neighborhood conservation across species

Recent taxonomic revisions have reclassified some potato plant isolates previously identified as Pectobacterium wasabiae to Pectobacterium parmentieri sp. nov. , suggesting that comparative genomic analyses should carefully consider the taxonomic status of the bacterial strains being examined.

What is the relationship between AlaE and other amino acid exporters in Pectobacterium species?

Pectobacterium species possess multiple amino acid exporters with varying substrate specificities and physiological roles. Research in E. coli identified several genes with L-alanine export activity, including ygaW (alaE), ytfF, yddG, and yeaS, though alaE demonstrated the most significant impact on both intracellular and extracellular L-alanine levels .

In Pectobacterium, a comprehensive analysis would:

  • Identify all putative amino acid exporter genes through genomic analysis

  • Compare their sequence similarities and predicted structures

  • Examine their expression patterns under different conditions

  • Determine their substrate specificities through functional assays

This approach would help place AlaE within the broader context of cellular amino acid transport systems and reveal potential functional redundancy or specialization among these transporters.

How might AlaE expression affect virulence in Pectobacterium plant pathogens?

The relationship between AlaE and virulence in Pectobacterium species involves several potential mechanisms:

  • Metabolic adaptation: L-alanine export may help the bacteria adapt to fluctuating amino acid availability in plant tissues during infection

  • pH tolerance: Amino acid decarboxylation and export systems often contribute to acid stress responses, which could be relevant during plant colonization

  • Nutrient acquisition: Modulation of amino acid pools might affect the expression of virulence factors

Experimental approaches to investigate this relationship would include:

  • Constructing alaE deletion mutants in Pectobacterium species

  • Comparing virulence of wild-type and mutant strains in plant infection models

  • Measuring expression of alaE during different stages of plant infection

  • Determining if alaE deletion affects expression of known virulence factors like the Flp/Tad pilus

Studies on Pectobacterium virulence have identified various determinants, including the Flp/Tad pilus-encoding gene cluster, which plays a significant role in maceration ability in potato tubers . Similar approaches could be applied to investigate AlaE's potential contribution to virulence.

What biotechnological applications could benefit from engineered Pectobacterium wasabiae AlaE?

Engineered AlaE transporters from Pectobacterium wasabiae could have several biotechnological applications:

  • Amino acid production: Enhanced L-alanine export could improve yields in bacterial strains engineered for L-alanine production, similar to how overexpression of ygaW (alaE) increased alanine production in E. coli expressing the alanine dehydrogenase gene (alaD)

  • Bioremediation: Modified exporters might facilitate removal of toxic amino acid analogs from contaminated environments

  • Biosensors: AlaE-based systems could be developed to detect L-alanine in various samples

  • Protein engineering platforms: Understanding AlaE structure-function relationships could inform design of novel transporters with altered specificities

Research has shown that co-expression of alaD and alaE genes in E. coli increased alanine production, with the alanine yield after 10 hours of cultivation increasing from 22.5% to 32.7% on a weight basis (g/g glucose) . Similar approaches could be applied using Pectobacterium wasabiae AlaE in various biotechnological contexts.

How can protein engineering approaches be used to modify the transport properties of AlaE?

To engineer AlaE proteins with modified transport properties, researchers should consider these methodological approaches:

  • Rational design: Based on structural models and homology to better-characterized transporters, target specific residues for mutation to alter substrate specificity, transport rate, or regulation

  • Domain swapping: Exchange domains between AlaE and other transporters to create chimeric proteins with novel properties

  • Directed evolution: Apply random mutagenesis and selection pressure to evolve variants with desired characteristics

  • Computational design: Use molecular dynamics simulations and computational modeling to predict mutations that might enhance desired properties

The engineering process should be iterative, with each round of modification followed by functional characterization to assess changes in:

  • Substrate specificity

  • Transport kinetics (Km and Vmax)

  • Regulation and expression

  • Protein stability in different environments

Such engineering efforts could yield variants with enhanced export capabilities, broader substrate ranges, or improved stability for biotechnological applications .

What are common challenges in purifying functional recombinant AlaE protein and how can they be addressed?

Purifying functional membrane proteins like AlaE presents several challenges that can be addressed through methodological refinements:

  • Protein aggregation:

    • Solution: Screen different detergents (DDM, LMNG, DMNG) at various concentrations

    • Add stabilizing agents like glycerol or specific lipids during purification

    • Consider amphipol or nanodisc reconstitution after initial purification

  • Low expression yields:

    • Solution: Test different expression hosts (E. coli C41/C43, LOBSTR)

    • Optimize induction conditions (lower temperatures, reduced inducer concentrations)

    • Consider fusion partners that enhance membrane protein expression (Mistic, SUMO)

  • Protein degradation:

    • Solution: Include protease inhibitors throughout purification

    • Minimize time between cell disruption and affinity purification

    • Optimize buffer components to enhance stability

  • Loss of function during purification:

    • Solution: Verify activity at each purification step using transport assays

    • Maintain critical lipids that might be required for function

    • Consider purification in proteoliposomes to maintain a lipid environment

These approaches should be systematically tested and optimized for the specific properties of Pectobacterium wasabiae AlaE.

How can researchers resolve inconsistent results when measuring AlaE transport activity?

When faced with inconsistent AlaE transport activity measurements, implement these troubleshooting approaches:

  • Standardize experimental conditions:

    • Maintain consistent cell growth phase for all experiments

    • Ensure precise temperature control during transport assays

    • Standardize buffer composition, particularly pH and ionic strength

  • Control for expression levels:

    • Quantify protein expression by Western blotting for each experiment

    • Normalize transport activity to actual protein levels

    • Consider using an inducible system with titratable expression

  • Address technical variability:

    • Perform biological replicates from independent transformations/cultures

    • Include positive and negative controls in each experiment

    • Develop internal standards for normalization between experiments

  • Validate multiple assay methods:

    • Compare results using different measurement techniques

    • Consider direct (radiolabeled substrate) and indirect (growth assays) methods

    • Verify that observed phenotypes are complemented by wild-type gene expression

A systematic approach to method validation using multiple complementary techniques will help distinguish genuine biological variation from technical artifacts.

What emerging technologies could advance our understanding of AlaE structure and function?

Several cutting-edge technologies are poised to revolutionize our understanding of AlaE:

  • Cryo-electron microscopy: Recent advances in single-particle cryo-EM now enable atomic resolution of membrane proteins as small as 50 kDa, potentially allowing visualization of AlaE structure in different conformational states

  • Native mass spectrometry: Can provide insights into protein-ligand interactions and oligomeric states of membrane proteins in near-native conditions

  • Hydrogen-deuterium exchange mass spectrometry: Could reveal dynamic regions and conformational changes associated with substrate binding and transport

  • Single-molecule FRET: May allow real-time observation of conformational changes during the transport cycle

  • AlphaFold and related AI approaches: Deep learning methods for protein structure prediction are increasingly accurate for membrane proteins and could provide structural models to guide experimental design

These technologies, particularly when used in combination, have the potential to resolve longstanding questions about the transport mechanism of AlaE.

How might systems biology approaches contribute to understanding the role of AlaE in bacterial metabolism?

Systems biology approaches can provide a holistic view of AlaE's role within bacterial metabolic networks:

Such approaches could reveal how AlaE activity is integrated with broader cellular functions and adaptation to different environmental niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.