Recombinant Pelagibacter ubique Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

Glycerol-3-phosphate acyltransferase (PlsY) catalyzes the first step of phospholipid biosynthesis, transferring an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This reaction is pivotal for membrane lipid assembly in bacteria lacking conventional acyl-ACP-dependent pathways .

Sequence highlights:

  • Contains conserved domains for acyl-phosphate binding and catalysis (e.g., motif regions I–IV) .

  • Predicted transmembrane helices align with structural models of bacterial GPATs .

Biological Role in Pelagibacter ubique

Pelagibacter ubique, a dominant marine SAR11 bacterium, relies on PlsY for lipid synthesis under nutrient-limited conditions:

  • Sulfur Limitation Adaptation: During sulfur stress, plsY expression remains stable, suggesting constitutive lipid synthesis despite riboswitch-mediated metabolic shifts .

  • Genome Streamlining: Loss of redundant lipid biosynthesis genes (e.g., plsX) in Pelagibacter makes PlsY indispensable for membrane integrity .

Functional Insights from Comparative Studies

  • Substrate Specificity: Unlike E. coli PlsB (acyl-ACP dependent), PlsY utilizes acyl-phosphate, bypassing the need for fatty acid biosynthesis intermediates .

  • Evolutionary Conservation: Phylogenetic analysis places PlsY within a clade of GPATs unique to oligotrophic bacteria, distinct from mitochondrial or peroxisomal isoforms in eukaryotes .

Applications in Research

  • Enzyme Kinetics: Used to study acyl-chain selectivity and regulatory mechanisms in minimal-genome bacteria .

  • Membrane Biogenesis: A model for understanding lipid adaptation in nutrient-poor marine environments .

Research Gaps and Future Directions

  • Structural Data: No crystal structure exists for PlsY; homology modeling is limited by low sequence similarity to characterized GPATs .

  • Regulatory Mechanisms: Role of SAM riboswitches in plsY expression under dynamic ocean conditions remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; SAR11_1082; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Pelagibacter ubique (strain HTCC1062)
Target Names
plsY
Target Protein Sequence
MEYLIVALSSYLLGSIPFGFILTKIFLKKDIRDIGSGNIGATNALRTGNKTLGYATLLLD ITKAVLPVLYVKFNYPDYIFIASLSAFLGHVFPIWLKFKGGKGVATYVGILFSINIFLGL VFIISWAVTFLISKYSSLSSLVGSLMVPMYLIVFENYNSIFFIIMFVLIFYTHRENVKRL KNKEETKTKIY
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Glycerol-3-phosphate acyltransferase (plsY) in Pelagibacter ubique?

PlsY in Pelagibacter ubique functions as a key enzyme in glycerophospholipid biosynthesis. It catalyzes the acylation of glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA), representing a critical step in membrane phospholipid synthesis. This reaction is essential for bacterial cell membrane formation and maintenance. Research indicates that PlsY works in conjunction with PlsX in a pathway that becomes essential when other parallel pathways are compromised, as evidenced by the synthetic lethality observed when both plsX and plsY genes are deleted . The enzyme likely evolved specific adaptations in Pelagibacter ubique to function efficiently in nutrient-limited marine environments, contributing to the organism's ability to maintain membrane integrity under oligotrophic conditions.

How does plsY contribute to glycerophospholipid synthesis in bacteria?

PlsY catalyzes the transfer of an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate, producing 1-acyl-glycerol-3-phosphate (lysophosphatidic acid or LPA). This reaction represents the first committed step in the glycerophospholipid synthesis pathway. Studies indicate that "PlsXY likely contributes to LPA synthesis, albeit a minor contribution compared to PlsB because individually PlsX and PlsY are not essential" . While the PlsY pathway is not the only route for LPA synthesis, with PlsB providing an alternative pathway using acyl-CoA as substrate, the PlsX/PlsY system becomes critical when PlsB activity is insufficient or compromised. The acylation reaction catalyzed by PlsY is particularly important because once G3P is acylated, it is committed to lipid synthesis pathways rather than being diverted to other metabolic processes.

What is the relationship between plsX and plsY in Pelagibacter ubique?

PlsX and PlsY function in a coordinated manner, forming a two-enzyme system for the acylation of glycerol-3-phosphate in phospholipid synthesis. Experimental evidence demonstrates "synthetic lethality of a plsXY double mutant, regardless of gene deletion order" . This genetic interaction suggests these enzymes provide a critical pathway that becomes essential when other parallel pathways are insufficient. The current model suggests PlsX generates acyl-phosphate from acyl-ACP, which PlsY then uses as a substrate for G3P acylation. This coordination is further supported by the observation that "PlsB overexpression suppressed the synthetic lethality of the plsXY double mutant" , indicating that enhancing an alternative pathway for LPA synthesis can compensate for the loss of both PlsX and PlsY. In Pelagibacter ubique, which has a streamlined genome adapted to oligotrophic marine environments, this coordinated system may be particularly important for efficient lipid metabolism under nutrient-limited conditions.

How is plsY expression regulated during different growth phases?

The regulation of plsY expression in Pelagibacter ubique likely changes during transitions between growth phases, particularly during the shift from exponential growth to stationary phase. During stationary phase, Pelagibacter ubique cells undergo a change in cell shape from vibroid to coccoid, with a corresponding decrease in cell volume . These morphological changes require significant membrane remodeling, suggesting potential regulation of lipid metabolism enzymes including plsY. Unlike some bacteria, Pelagibacter ubique lacks the stationary-phase sigma factor σS , indicating it must employ alternative regulatory mechanisms for stationary phase adaptation. The observation that cells can "return to both exponential growth and a vibroid cell shape after being transferred to fresh medium" suggests a reversible regulation of genes involved in cell morphology and membrane structure, likely including plsY. This regulation may involve transcriptional control, post-translational modifications, or changes in substrate availability that affect plsY activity.

How does the synthetic lethality of ΔplsXY mutants inform our understanding of lipid metabolism?

The synthetic lethality observed in ΔplsXY mutants provides critical insights into the organization and redundancy of bacterial lipid metabolism pathways. Co-transduction experiments conclusively demonstrated "synthetic lethality of a plsXY double mutant, regardless of gene deletion order" , showing that cells cannot survive without either the PlsX/PlsY pathway or an alternative functional pathway for lysophosphatidic acid (LPA) synthesis. This synthetic lethality indicates that while individual deletions of plsX or plsY are tolerated, the complete loss of this pathway becomes lethal when other pathways cannot fully compensate. The observation that "PlsB overexpression suppressed the synthetic lethality of the plsXY double mutant" confirms that the critical function requiring preservation is LPA synthesis. This redundancy in LPA synthesis pathways likely provides metabolic flexibility, allowing bacteria to maintain membrane phospholipid synthesis under varying environmental conditions or metabolic states. In Pelagibacter ubique, with its streamlined genome evolved for oligotrophic environments, understanding these redundant yet essential pathways provides insights into the minimal lipid metabolism machinery required for cellular viability.

What mechanisms underlie the suppression of ΔplsXY synthetic lethality?

Research has identified two primary mechanisms that can suppress the synthetic lethality of ΔplsXY mutants, both converging on increasing glycerol-3-phosphate (G3P) availability. Whole-genome sequencing of suppressors revealed mutations primarily in GlpR and PstS . GlpR functions as "a repressor of the glp regulon, composed of nine genes that help balance G3P levels" . Suppressor mutations in GlpR included "single nucleotide mutations, deletion of base pairs, and insertion of mobile elements" that likely resulted in loss of GlpR function , leading to derepression of the glp regulon and increased G3P levels. Similarly, mutations in PstS affected "the PstSABC complex that activates the DNA-binding regulator PhoB in response to the level of environmental inorganic phosphate" . These mutations result in constitutive activation of PhoB-regulated genes, including the ugpBAECQ operon encoding a G3P uptake system . Additionally, direct supplementation with G3P was shown to suppress the synthetic lethality: "Strains were plated on LB kan supplemented with 5 mM NaCitrate and 0.2% G3P and incubated until colonies formed" . These findings suggest that increased G3P concentration can compensate for the loss of PlsX and PlsY, possibly by providing sufficient substrate for the less efficient PlsB pathway.

How do alterations in acyl-ACP pools relate to plsY function?

The relationship between acyl-ACP pools and plsY function provides insights into the integration of fatty acid and phospholipid synthesis. Research has outlined three potential scenarios for how deletion of plsX or plsY might affect acyl-ACP pools, each with different implications for understanding plsY function :

ScenarioAcyl-ACP Pool ChangeImplication for PlsY Function
1Decreased total acyl-ACPsPlsY may help stimulate FASII initiation
2Accumulated medium-chain (C12-C14) acyl-ACPsPlsY may regulate LPS/GPL balance by affecting LpxC or FabZ activity
3Accumulated long-chain (C18-C20) acyl-ACPsPlsY may prevent feedback inhibition of FASII initiation

The scenario observed in experimental studies would provide critical information about plsY's broader role in coordinating fatty acid and phospholipid metabolism. In Pelagibacter ubique, with its highly streamlined genome and adaptation to oligotrophic environments, efficient coordination between fatty acid synthesis and phospholipid formation is likely crucial for survival. Changes in acyl-ACP pool composition could affect membrane fatty acid composition, impacting membrane fluidity and permeability, which are particularly important for adaptation to the marine environment where Pelagibacter ubique naturally occurs.

How might G3P metabolism connect to plsY function in Pelagibacter ubique?

G3P metabolism is intricately connected to plsY function, with significant implications for understanding Pelagibacter ubique physiology. The observation that increased G3P levels can suppress ΔplsXY synthetic lethality highlights the critical role of G3P availability in phospholipid synthesis. In Pelagibacter ubique, which thrives in nutrient-limited marine environments, efficient utilization of available G3P for phospholipid synthesis would be essential. During the transition to stationary phase, when Pelagibacter ubique undergoes a change in cell shape from vibroid to coccoid with decreased cell volume , G3P metabolism may be particularly important for membrane remodeling. The connection between G3P and plsY function involves several regulatory networks, including those controlled by GlpR and PhoB . GlpR regulates the glp regulon that helps balance G3P levels, while PhoB regulates genes involved in G3P uptake. Disruption of either regulatory system can increase G3P availability and suppress plsY-related defects . This suggests that in wild-type cells, plsY function must be coordinated with G3P metabolism to maintain appropriate membrane phospholipid synthesis under varying environmental conditions.

What are the implications of plsY research for understanding bacterial adaptation to nutrient limitation?

Research on plsY has significant implications for understanding how bacteria adapt to nutrient limitation, particularly in organisms like Pelagibacter ubique that thrive in oligotrophic environments. Pelagibacter ubique undergoes morphological changes during stationary phase, transitioning from vibroid to coccoid shape with decreased cell volume , suggesting significant membrane remodeling during nutrient limitation. The enzyme plsY, as a key component of membrane phospholipid synthesis, likely plays an important role in this adaptation. The observation that mutations affecting G3P metabolism can compensate for deficiencies in the PlsX/PlsY pathway indicates a complex relationship between central carbon metabolism and membrane lipid synthesis during nutrient stress. Additionally, research on Pelagibacter ubique has revealed distinct proteomic responses to nutrient limitation: "two distinct responses were observed, one as DMSP became exhausted and another as the cells acclimated to a sulfur-limited environment" . By understanding how plsY and related enzymes function under nutrient limitation, researchers can gain insights into the minimal cellular machinery required for survival in oligotrophic environments, with potential applications for understanding microbial ecology in nutrient-poor habitats and the evolution of streamlined genomes.

What expression systems are recommended for recombinant Pelagibacter ubique plsY?

Expressing recombinant Pelagibacter ubique plsY presents unique challenges that require careful consideration of expression systems. Based on the properties of this enzyme and the characteristics of Pelagibacter ubique, several approaches can be recommended:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3) with codon optimizationWell-established system, high yieldsMay require membrane-fraction extraction
E. coli C41/C43 strainsDesigned for membrane protein expressionLower yields but better folding
Cold-adapted expression hostsBetter folding at lower temperaturesCompatible with marine enzyme properties
Cell-free expression systemsAvoids toxicity issuesRequires supplementation with lipids/membranes
Co-expression with plsXMay enhance stability/activityBased on functional relationship observed

For optimal expression, the gene sequence should be codon-optimized for the expression host, considering Pelagibacter ubique's A+T-rich genome. Expression as a fusion protein with solubility-enhancing tags (MBP, SUMO) can improve yield and facilitate purification. Based on the apparent functional relationship between PlsX and PlsY evidenced by their synthetic lethality , co-expression with PlsX might enhance stability or facilitate proper folding. Temperature control is crucial, with lower temperatures (15-20°C) often improving the solubility of proteins from marine organisms. For membrane-associated enzymes like plsY, providing appropriate membrane mimetics (detergents, nanodiscs) during extraction and purification is essential for maintaining activity.

How can plsY activity be measured in biochemical assays?

Measuring plsY activity requires assays that can detect the formation of lysophosphatidic acid (LPA) from glycerol-3-phosphate and acyl donors. Several approaches can be employed, each with specific advantages:

Assay MethodPrincipleDetectionAdvantages
Radiometric assayTransfer of labeled G3P to LPAScintillation countingHigh sensitivity, quantitative
Coupled enzyme assayLink LPA formation to NAD(P)H oxidationSpectrophotometricContinuous monitoring, no radioactivity
LC-MS analysisDirect detection of LPA productMass spectrometryDetailed product analysis, no labels needed
Fluorescent substrate analogsFRET-based detection of activityFluorescenceHigh-throughput compatible

What genetic approaches are effective for studying plsY function?

Studying plsY function in Pelagibacter ubique requires sophisticated genetic approaches that account for the organism's unique characteristics. Based on methodologies described in related research, several effective approaches can be employed:

Genetic ApproachApplicationMethodology Notes
Gene deletion with complementationAssess essentiality and functional domainsCareful design of suicide vectors for homologous recombination
Suppressor mutation analysisIdentify genetic interactions"Mutations were identified by whole-genome sequencing (WGS)"
Conditional expression systemsStudy essential genes"PlsB overexpression suppressed the synthetic lethality"
Site-directed mutagenesisStructure-function analysisFocus on predicted catalytic residues
Heterologous expressionComplementation studiesExpression in model organisms with plsY deletion

For gene deletion studies, the approach used in related research can be adapted: "Following P1 transduction into a ΔplsX recipient strain, bacteria were selected on kanamycin and screened for both gene deletion, via primers that anneal to regions flanking plsY, and gene duplication, via primers that anneal to regions within plsY" . When studying potentially essential genes like plsY, conditional expression systems or suppressor analysis are particularly valuable. The suppressor isolation approach described in the literature provides a useful framework: "To identify genes that overcome the synthetic lethal phenotype, we isolated suppressors via large-scale transduction... and mutations were identified by whole-genome sequencing" . For Pelagibacter ubique specifically, genetic manipulations should account for the organism's slow growth, small cell size, and potential differences in DNA uptake efficiency compared to model organisms.

What considerations are important for structural studies of plsY?

Structural studies of Pelagibacter ubique plsY require careful consideration of several factors to obtain biologically relevant results. The enzyme's membrane association, substrate binding requirements, and potential conformational changes during catalysis present specific challenges:

Structural MethodApplicationsSpecial Considerations
X-ray crystallographyHigh-resolution static structureRequires stable crystal packing, challenging for membrane proteins
Cryo-EMVisualization of different conformational statesMay require incorporation into nanodiscs or amphipols
NMR spectroscopyDynamic information, substrate bindingSize limitations, requires isotopic labeling
Molecular dynamics simulationsConformational changes, membrane interactionsRequires initial structure as starting point
Homology modelingInitial structural predictionsBenefit from modeling "binding pocket...consists of several conserved positively charged amino acids"

For successful structural studies, protein preparation is critical. The putative glycerol-3-phosphate binding pocket in related enzymes "consists of several conserved positively charged amino acids, namely His-139, Lys-193, His-194, Arg-235, and Arg-237" , suggesting these residues should be preserved in any construct design. The functional relationship between PlsX and PlsY indicated by their synthetic lethality suggests that co-crystallization or structural studies of the complex might provide additional insights. For membrane protein structural studies, the choice of detergent or membrane mimetic is crucial, with options including detergent micelles, nanodiscs, and lipidic cubic phases. Structural studies should ideally capture different functional states, possibly using substrate analogs or inhibitors like the "benzoic and phosphonic acids" that have been designed to target GPAT .

What approaches can be used to study plsY localization in bacterial cells?

Investigating the subcellular localization of plsY provides insights into its functional context within bacterial cells. Several complementary approaches can be employed to study plsY localization in Pelagibacter ubique or model bacterial systems:

Localization MethodInformation ProvidedTechnical Considerations
Fluorescent protein fusionsReal-time visualization in living cellsMust verify fusion protein functionality
Immunofluorescence microscopyEndogenous protein localizationRequires specific antibodies
Membrane fractionationBiochemical association with membrane domainsCan distinguish inner vs. outer membrane
Cryo-electron tomographyHigh-resolution spatial contextRequires specialized equipment
FRET-based interaction studiesProximity to other proteinsCan reveal functional complexes

When designing fluorescent protein fusions, careful consideration should be given to the orientation (N- or C-terminal fusions) to avoid disrupting membrane insertion or function. Given the morphological changes observed in Pelagibacter ubique during stationary phase, where cells "undergo a change in cell shape from vibroid to coccoid, with a corresponding decrease in cell volume" , studying plsY localization during this transition could be particularly informative. The potential functional relationship with PlsX suggested by their synthetic lethality indicates that co-localization studies of these enzymes might reveal important aspects of their coordination. For membrane fractionation studies, the approach should account for the small cell size of Pelagibacter ubique and potentially unique membrane properties adapted to marine environments. Time-lapse imaging during growth phase transitions or in response to nutrient limitation could provide insights into dynamic changes in plsY localization related to its function in membrane lipid synthesis.

How should researchers interpret acyl-ACP pool changes in relation to plsY function?

Interpreting acyl-ACP pool changes provides crucial insights into plsY's role in lipid metabolism. Research has outlined three potential scenarios for how alterations in plsY function might affect acyl-ACP pools, each with specific interpretations :

Acyl-ACP Pool ChangeInterpretationImplications for Research
Decreased total acyl-ACPsPlsY may stimulate FASII initiationInvestigate regulatory interactions with FASII enzymes
Accumulated medium-chain (C12-C14) acyl-ACPsPlsY may regulate LPS/GPL balanceExamine coordination with LpxC and FabZ activities
Accumulated long-chain (C18-C20) acyl-ACPsPlsY may prevent feedback inhibitionStudy interaction with FASII regulatory mechanisms

When analyzing acyl-ACP profile data, researchers should consider both the absolute levels of different chain-length species and their relative proportions. Changes in specific acyl-ACP species may indicate redirected flux between competing pathways. For example, "an accumulation of medium-chain (C12 and C14) acyl-ACPs...may increase LPS flux and reduce the quantity of acyl-ACPs being elongated for GPL flux" . Time-course analyses are particularly valuable, as they can reveal the sequential effects of plsY perturbation on fatty acid metabolism. For Pelagibacter ubique specifically, the acyl-ACP profile should be interpreted in the context of the organism's natural marine environment and membrane composition requirements. Correlation analysis between acyl-ACP profiles and membrane phospholipid composition can provide further insights into how plsY function affects the ultimate fate of fatty acids in cell membrane structures.

What statistical approaches are most appropriate for analyzing plsY enzyme kinetics?

Analyzing plsY enzyme kinetics requires appropriate statistical approaches to accurately determine kinetic parameters and compare enzyme variants or conditions. Based on established practices in enzyme kinetics and approaches mentioned in the literature, several statistical methods are recommended:

Statistical ApproachApplicationImplementation Notes
Non-linear regressionDetermining Km, Vmax, kcatUse enzyme kinetics models (Michaelis-Menten, allosteric)
Global fittingAnalyzing inhibition mechanismsSimultaneously fit multiple datasets with shared parameters
Residual analysisValidating model appropriatenessCheck for systematic deviations from fitted curves
Bootstrap analysisEstimating parameter confidence intervalsParticularly useful for complex kinetic models
ANOVA with post-hoc testsComparing activity across conditions"Each reaction was performed in triplicate" for statistical validity

For inhibitor studies, dose-response curve fitting is appropriate: "IC50 values were then calculated based on the amount of inhibitor needed to produce 50% inhibition compared to the DMSO vehicle control" . When comparing kinetic parameters across different enzyme variants or conditions, statistical significance should be determined using appropriate tests, with Bonferroni or similar corrections applied for multiple comparisons. For time-course data, consideration should be given to product inhibition or substrate depletion effects. Plotting residuals (the difference between observed and fitted values) can reveal systematic deviations that might indicate more complex kinetic mechanisms than initially assumed. Researchers should report not just best-fit values but also confidence intervals for all kinetic parameters to transparently communicate the precision of their measurements.

How can researchers integrate structural predictions with functional data for plsY?

Integrating structural predictions with functional data provides a powerful approach to understanding plsY mechanistic details. Several strategies can effectively combine these complementary data types:

Integration StrategyApplicationImplementation Approach
Structure-guided mutagenesisTesting predicted functional residuesFocus on "conserved positively charged amino acids" in binding pocket
Molecular dockingPredicting substrate/inhibitor interactionsUse compounds mimicking "phosphate group of glycerol-3-phosphate"
MD simulations of variantsPredicting effects of mutationsCompare wild-type and variant dynamics
Conservation mappingIdentifying functionally important regionsAlign sequences across diverse bacterial species
Integrative modelingCombining experimental constraintsIncorporate biochemical and biophysical data

The design principles for GPAT inhibitors provide a framework for understanding important structural features: "structures with a negative charge at physiological pH to mimic the phosphate group of glycerol-3-phosphate and a long saturated chain to mimic the chain of palmitoyl-CoA" . These features likely reflect key aspects of the enzyme's substrate binding site. When interpreting the effects of mutations on enzyme function, structural context is essential. For instance, mutations affecting residues in the glycerol-3-phosphate binding pocket, which in related enzymes "consists of several conserved positively charged amino acids" , would likely have different effects than mutations in regions involved in membrane association. The synthetic lethality relationship between plsX and plsY suggests potential protein-protein interactions that could be investigated through structural studies. Molecular dynamics simulations can provide insights into how substrate binding might induce conformational changes and how these dynamics might differ between wild-type enzyme and variants with altered activity.

What approaches are effective for analyzing plsY expression under different growth conditions?

Analyzing plsY expression under different growth conditions requires multi-faceted approaches that can capture transcriptional, translational, and post-translational regulation. Based on methodologies from related research, several effective approaches can be employed:

Analysis ApproachInformation ProvidedMethodology Notes
RT-qPCRTranscriptional regulationNormalize to stable reference genes
RNA-SeqGenome-wide expression context"Increased transcription and translation" were observed in related studies
ProteomicsProtein abundance changesProteins were "up to 33 times more abundant" under certain conditions
Ribosome profilingTranslation efficiencyDistinguishes transcriptional vs. translational control
Reporter gene fusionsPromoter activity in vivoCan reveal condition-specific regulation

When studying expression in Pelagibacter ubique, researchers should pay particular attention to growth phase transitions, as the organism shows distinct responses between exponential growth and stationary phase: "two distinct responses were observed, one as DMSP became exhausted and another as the cells acclimated to a sulfur-limited environment" . The proteomic approach used in Pelagibacter ubique research provides a valuable template: "Protein and mRNA expression were measured before, during, and after the transition from exponential growth to stationary phase" . For comprehensive analysis, integration of transcriptomic and proteomic data is recommended to distinguish between transcriptional and post-transcriptional regulation. When analyzing gene expression data statistically, time-course experiments should be analyzed using appropriate methods for repeated measures, and correction for multiple testing should be applied for genome-wide analyses.

How should researchers approach comparative genomic analysis of plsY across bacterial species?

Comparative genomic analysis of plsY across bacterial species can provide valuable insights into evolutionary conservation, adaptation, and functional importance. Based on bioinformatic principles and the biological context of plsY, several approaches are recommended:

Comparative ApproachResearch QuestionAnalytical Method
Sequence conservation analysisIdentify catalytic residuesMultiple sequence alignment with conservation scoring
Phylogenetic analysisEvolutionary history and horizontal gene transferMaximum likelihood or Bayesian phylogenetic methods
Genomic context analysisFunctional associationsExamine gene neighborhood and operonic structure
Selection pressure analysisFunctional constraintsCalculate dN/dS ratios across sequences
Structural homology modelingStructural conservationThread sequences onto known structures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.