Recombinant Pelagibacter ubique Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pelagibacter ubique lipoprotein signal peptidase (LspA) is a bacterial enzyme critical for processing lipoproteins in the marine alphaproteobacterium Candidatus Pelagibacter ubique, a dominant member of oceanic microbial communities. LspA, encoded by the lspA gene (SAR11_0157 locus), belongs to the family of signal peptidase II enzymes (EC 3.4.23.36) that cleave the signal peptide from prolipoproteins, enabling their maturation and membrane localization . This enzyme is essential for bacterial survival, making it a target for antibiotic development .

LspA cleaves the conserved lipobox motif (LXXC) in prolipoproteins, removing the signal peptide to generate mature lipoproteins. Substrate recognition involves:

  • Binding to the lipid-modified cysteine residue.

  • Hydrolysis of the peptide bond between glycine and cysteine in the lipobox .

Biological Role in Pelagibacter ubique

  • Nutrient Limitation Adaptation: During stationary phase, P. ubique upregulates stress-response proteins like OsmC and thioredoxin reductase but maintains LspA expression to ensure continued lipoprotein processing .

  • Genomic Streamlining: Despite lacking global regulatory systems (e.g., σ<sup>S</sup>), P. ubique retains lspA as part of its minimal genome (1.3 Mbp), highlighting its essentiality .

  • Nitrogen Metabolism: While lspA itself is not nitrogen-regulated, P. ubique prioritizes nitrogen assimilation via AmtB transporters and aminotransferases under nitrogen-limited conditions .

Expression and Purification

Recombinant LspA is heterologously expressed in Escherichia coli systems, yielding soluble protein with retained activity . Key parameters include:

ParameterDetails
Expression VectorpET or pGEX systems
InductionIPTG-induced T7 promoter
Yield50 µg per batch (commercially available)

Research Applications

  • Antibiotic Development: LspA inhibitors like globomycin and myxovirescin block lipoprotein processing, offering therapeutic potential against Gram-negative pathogens .

  • Structural Studies: Cryo-EM and X-ray crystallography of recombinant LspA have elucidated inhibitor-binding mechanisms, guiding drug design .

  • Ecological Studies: Tracking LspA expression in marine microbiomes provides insights into P. ubique’s survival strategies .

Biochemical Properties

PropertyValue/Observation
Optimal pH7.0–8.0 (Tris buffer)
InhibitionGlobomycin (IC<sub>50</sub> = 0.2 µM), Myxovirescin (IC<sub>50</sub> = 1.5 µM)
ThermostabilityStable at 4°C for one week; sensitive to repeated freeze-thaw cycles

Evolutionary and Ecological Significance

  • Evolutionary Conservation: LspA is conserved across SAR11 clades, with phylogenetic analyses placing P. ubique as a sister taxon to Rickettsiales .

  • Oceanic Carbon Cycling: By processing lipoproteins for nutrient transporters, LspA supports P. ubique’s role in metabolizing dissolved organic carbon (DOC), which constitutes ~25% of oceanic microbial cells .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
lspA; SAR11_0157; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Pelagibacter ubique (strain HTCC1062)
Target Names
lspA
Target Protein Sequence
MNKINLKNFYLNLVIILVVFIFDRTTKLYILKLAEVETSVDIYITPFLNLFLIWNKGIAF GLFSIDGSVIYNSITILIGLIIIAIIFMMLKNDNIQRYFFALIAGGAFGNFYDRIVYTAV PDFIDLHFYGFHWFVFNVADIFITIGVFCLILVELFFNNKKTNEKN
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research: What expression systems are most suitable for producing recombinant P. ubique LspA?

Based on successful expression of recombinant LspA from other bacterial species, the following expression systems would be most appropriate:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, established protocolsMay require codon optimization for P. ubique genes
E. coli C41/C43Designed for membrane proteinsBetter for toxic membrane proteins
Cell-free systemsAvoids toxicity issuesMay have lower yields

Research with R. typhi LspA demonstrated successful expression in E. coli systems, with functional activity confirmed through globomycin resistance assays and genetic complementation . When expressing P. ubique LspA, similar methodologies could be employed, though codon optimization might be necessary given P. ubique's AT-rich genome. Purification protocols should include detergent screening to maintain LspA in its native conformation.

Advanced Research: How can the conformational dynamics of P. ubique LspA be effectively studied?

To characterize the conformational dynamics of P. ubique LspA, researchers should consider a hybrid approach combining:

  • Molecular Dynamics (MD) simulations to examine nanosecond timescale fluctuations

  • Electron Paramagnetic Resonance (EPR) spectroscopy to validate computational models

  • Site-directed spin labeling at strategic locations, particularly the periplasmic helix

This hybrid experimental design has proven effective for understanding LspA conformational states in other bacteria, revealing that LspA typically samples multiple conformations . The periplasmic helix (PH) of LspA fluctuates on the nanosecond timescale, with:

  • A closed conformation in the apo state that occludes the charged active site from the lipid bilayer

  • Multiple intermediate conformations when bound to inhibitors like globomycin

  • An open conformation that allows substrate binding

These methodologies would help establish if P. ubique LspA follows similar conformational dynamics or has evolved unique characteristics for its marine environment.

Advanced Research: What methodological approaches are recommended for studying the interaction between P. ubique LspA and potential inhibitors?

To characterize inhibitor interactions with P. ubique LspA:

  • Express recombinant LspA in E. coli and confirm activity through complementation of temperature-sensitive E. coli LspA mutants (similar to studies with R. typhi LspA)

  • Test globomycin resistance as an initial functional assay

  • Employ distance measurements using EPR with site-specific labels to monitor conformational changes upon inhibitor binding

  • Use continuous wave (CW) EPR to detect multiple conformational states

Based on studies with other bacterial LspA proteins, globomycin binding stabilizes an intermediate conformation that inhibits signal peptide cleavage and substrate binding . The different conformations observed in both bound and apo states indicate a flexible and adaptable active site, which explains how LspA accommodates various substrates.

Conformational StateExperimental TechniqueExpected Observation
Closed (apo)DEER EPRShortest distance between β-cradle and PH
Intermediate (inhibitor-bound)CW EPR/DEERMultiple distance populations
Open (substrate-binding)MD simulationWidest cavity for substrate binding

Basic Research: What are the essential controls needed when performing functional assays with recombinant P. ubique LspA?

When performing functional assays with recombinant P. ubique LspA, the following controls are essential:

  • Positive control: E. coli LspA expressed under identical conditions, as demonstrated in R. typhi LspA studies

  • Negative control: Empty vector controls for expression systems

  • Catalytic mutant control: Site-directed mutants of catalytic aspartate residues that should eliminate activity

  • Conformational stability control: Circular dichroism (CD) measurements to confirm proper folding

For globomycin resistance assays, a dose-response curve should be established with concentrations ranging from 12.5 μg/ml to 200 μg/ml, similar to protocols used for R. typhi LspA testing . Statistical significance should be established using appropriate tests (e.g., Student's t-test) when comparing growth rates between test and control conditions.

Advanced Research: How does the expression of lspA in P. ubique vary under different environmental conditions?

While specific data on P. ubique lspA expression is not detailed in the provided search results, research could be designed based on the methodology used for Rickettsia typhi:

  • Design species-specific primers for P. ubique lspA

  • Establish real-time quantitative RT-PCR protocols to monitor transcript levels

  • Compare expression under various environmental stressors relevant to marine environments:

    • Iron limitation

    • Nitrogen limitation

    • Phosphorus limitation

    • Temperature variations

    • Salinity gradients

In R. typhi, lspA showed differential expression patterns during various stages of intracellular growth, with higher expression at pre-infection stages and after bacterial doubling time . For P. ubique, transcriptional studies should be integrated with proteomic analyses, as was done in the nutrient limitation studies mentioned in the search results .

Advanced Research: How can contradictory data in P. ubique LspA functional studies be resolved?

When faced with contradictory data in P. ubique LspA functional studies:

  • Examine expression constructs for differences in fusion tags, which may affect membrane insertion

  • Verify membrane localization using fractionation techniques followed by Western blotting

  • Consider detergent effects on activity measurements

  • Implement multiple, complementary functional assays:

    • Globomycin resistance

    • Genetic complementation

    • Direct enzymatic activity measurements

Based on R. typhi LspA studies, there may be disparities between globomycin binding and prolipoprotein processing activities, suggesting these are independent cellular activities . If contradictory results are observed between different functional assays, this could indicate distinct aspects of LspA function.

Basic Research: What protocols ensure reproducible activity measurements of recombinant P. ubique LspA?

To ensure reproducible activity measurements:

  • Standardize expression conditions (temperature, induction time, media composition)

  • Develop consistent membrane extraction protocols with gentle detergents

  • Quantify protein concentration using methods compatible with membrane proteins

  • Establish temperature, pH, and ionic strength optima for activity assays

  • Use internal standards for comparative analyses between experiments

For genetic complementation assays in temperature-sensitive E. coli strains, the incubation temperature and time should be carefully controlled. In R. typhi LspA studies, the temperature-sensitive E. coli Y815 strain was used at the nonpermissive temperature (42°C) , and similar approaches would be suitable for P. ubique LspA.

Advanced Research: What approaches enable structural studies of P. ubique LspA to inform inhibitor design?

For structural studies to inform inhibitor design:

  • Protein stabilization: Identify optimal detergent/lipid conditions that maintain native conformation

  • Crystallization screening: Employ membrane protein-specific crystallization screens

  • Cryo-EM: Consider single-particle analysis if crystallization proves challenging

  • Structure-guided design:

    • Map the catalytic dyad and conserved residues

    • Identify potential binding pockets through computational docking

Studies of other bacterial LspA proteins revealed that the catalytic dyad and 14 additional highly conserved residues surrounding the active site are potential targets for inhibitor design . The extensive conservation suggests that resistance mutations affecting inhibitor binding would likely interfere with substrate binding and cleavage, making LspA a promising target to combat antibiotic resistance.

Advanced Research: How can molecular dynamics simulations be optimized for studying P. ubique LspA embedded in a membrane environment?

For optimized MD simulations of membrane-embedded P. ubique LspA:

  • Build a homology model based on available LspA structures if direct structural data is unavailable

  • Embed the protein in a lipid bilayer that mimics the P. ubique membrane composition

  • Implement extended simulation times (>100 ns) to capture conformational dynamics

  • Apply appropriate force fields optimized for membrane proteins

  • Validate simulations with experimental restraints from EPR or other biophysical methods

The MD approach should aim to capture the three key conformational states observed in other LspA proteins: closed (apo), intermediate (inhibitor-bound), and open (substrate-binding) . The trigonal cavity formed in the open conformation is particularly important as it represents the only structure where lipoprotein substrate could sterically fit in the active site.

Basic Research: What are the key considerations for designing primers for P. ubique lspA gene amplification?

When designing primers for P. ubique lspA amplification:

  • Consider the AT-rich genome composition of P. ubique

  • Include appropriate restriction sites for subsequent cloning

  • Design primers with optimal:

    • Length (20-30 nucleotides)

    • GC content (40-60%)

    • Melting temperature (55-65°C)

  • Add appropriate tags for protein detection and purification

  • Optimize codon usage for the chosen expression system

For expression in E. coli, consider adding a hexahistidine tag as was done in studies with R. typhi LspA to facilitate purification by affinity chromatography . Verify primer specificity against the P. ubique genome to avoid non-specific amplification.

Advanced Research: How can site-directed mutagenesis be effectively applied to study P. ubique LspA structure-function relationships?

For effective site-directed mutagenesis studies:

  • Target the catalytic dyad aspartate residues predicted to abolish activity

  • Mutate residues in the periplasmic helix to understand conformational dynamics

  • Alter conserved residues near the active site to investigate substrate specificity

  • Create chimeric proteins with regions from other bacterial LspA proteins to identify species-specific functions

Based on studies with other LspA proteins, the periplasmic helix is particularly important for conformational changes associated with substrate binding and catalysis . Mutations that alter the flexibility or positioning of this helix would provide valuable insights into the mechanism of action.

Basic Research: What challenges are specific to maintaining stability of purified recombinant P. ubique LspA?

Specific challenges for P. ubique LspA stability include:

  • Membrane protein solubility in aqueous buffers

  • Potential cold sensitivity (given P. ubique's adaptation to marine environments)

  • Detergent selection that maintains native conformation without denaturing the protein

  • Long-term storage conditions that preserve activity

Recommended approaches include:

ChallengeMethodological Solution
Detergent selectionSystematic screening of mild detergents (DDM, LMNG, etc.)
Stability assessmentThermal shift assays to identify optimal buffer conditions
Cold sensitivityTest activity at varying temperatures (4-30°C)
Long-term storageEvaluate glycerol, sucrose, or flash-freezing in lipid nanodiscs

Advanced Research: How can transcriptomic and proteomic analyses be integrated to understand P. ubique lspA regulation?

To integrate transcriptomic and proteomic approaches:

  • Perform RNA-Seq under multiple environmental conditions

  • Couple with quantitative mass spectrometry for protein expression analysis

  • Compare transcript and protein levels to identify post-transcriptional regulation

  • Map the lspA genomic context to identify potential regulatory elements

  • Analyze co-expression patterns with other lipoprotein processing genes (e.g., lgt)

This integrated approach was mentioned for studying P. ubique under nutrient limitation and would be valuable for understanding lspA regulation. In R. typhi, lspA and lgt showed similar expression patterns, while lepB (encoding SPase I) showed higher expression levels, suggesting differential regulation of lipoprotein versus non-lipoprotein secretion pathways .

Advanced Research: What methodological considerations are important when studying LspA inhibition in P. ubique compared to pathogenic bacteria?

When studying LspA inhibition in P. ubique compared to pathogens:

  • Consider evolutionary conservation of the active site and substrate binding regions

  • Evaluate inhibitor binding under conditions relevant to marine environments

  • Compare inhibition kinetics at different temperatures relevant to ocean conditions

  • Assess potential ecological consequences of LspA inhibition in marine bacteria

Studies with pathogenic bacteria have shown that LspA is a promising antibiotic target because conserved residues in the active site mean that resistance mutations would likely interfere with normal enzyme function . For P. ubique, inhibitor studies should consider both biochemical implications and potential ecological consequences, as this organism represents approximately 25% of marine microbial communities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.