Recombinant Pelagibacter ubique NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; SAR11_0883; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Pelagibacter ubique (strain HTCC1062)
Target Names
nuoA
Target Protein Sequence
MLSEFLKDYLPIIIFLIIALGLSCAFVVVNLILSPKHPDPEKLSAYECGFEPFEDSRMEF DVRFYLVAILFIIFDLEIAFLFPWAISLGNIGGLGFTSMMIFLFILTVGFIYEWKKGALD WE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thus conserving redox energy in a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of NADH-quinone oxidoreductase in Candidatus Pelagibacter ubique?

NADH-quinone oxidoreductase (Complex I) in Candidatus Pelagibacter ubique functions as a crucial component of the electron transport chain. This enzyme catalyzes the transfer of electrons from NADH to quinone, coupled with proton translocation across the membrane, thereby contributing to energy conservation in this highly streamlined organism. Unlike more complex bacteria, C. Pelagibacter ubique has evolved a minimalist genome (1.3 Mb) with highly efficient metabolic systems, making its respiratory complexes particularly important for survival in nutrient-limited marine environments .

How does nuoA function within the NADH-quinone oxidoreductase complex?

The nuoA subunit serves as one of the membrane components of the NADH-quinone oxidoreductase complex. While the complete structure of the C. Pelagibacter ubique complex hasn't been fully characterized, comparative analysis with other bacterial systems suggests that nuoA contributes to the membrane arm of the complex and participates in the proton-pumping function. This subunit is critical for proper assembly and stability of the respiratory complex, ensuring efficient energy transduction in these energy-limited marine bacteria .

Why is studying recombinant nuoA from C. Pelagibacter ubique significant for understanding marine microbial ecology?

Studying recombinant nuoA from C. Pelagibacter ubique provides insights into the energy metabolism of the most abundant heterotrophic marine bacteria on Earth. These organisms account for approximately 25% of all microbial plankton cells, and in summer may comprise nearly half of all cells in temperate ocean surface waters . Their estimated global abundance of 2×10^28 cells means they play a critical role in marine carbon cycling. Understanding how these organisms generate energy through their respiratory complexes under nutrient-limited conditions helps explain their ecological success and provides insights into fundamental adaptations for survival in oligotrophic marine environments .

What are effective expression systems for producing recombinant nuoA from C. Pelagibacter ubique?

Based on experimental approaches with similar membrane proteins, the most effective expression systems for nuoA from C. Pelagibacter ubique include:

Expression System Options:

SystemAdvantagesDisadvantagesSpecial Considerations
E. coli BL21(DE3)High yield, well-established protocolsPotential for inclusion bodiesRequires optimization of induction temperature (16-20°C) and IPTG concentration
E. coli SHuffle T7Enhanced disulfide bond formationLower yield than BL21Beneficial for proteins with disulfide bonds
Cell-free expressionAvoids toxicity issues, direct membrane integrationHigher cost, lower scalabilityUseful for difficult-to-express membrane proteins

The choice of expression tag (His6, GST, or MBP) significantly impacts solubility. For membrane proteins like nuoA, fusion to MBP often enhances solubility, while a C-terminal His-tag facilitates purification without disrupting membrane insertion. Codon optimization for E. coli is essential given the A-T rich genome of C. Pelagibacter ubique .

What purification strategies are most effective for recombinant nuoA?

Purification of recombinant nuoA requires specialized approaches for membrane proteins:

  • Membrane fraction isolation: Following cell lysis, differential ultracentrifugation (40,000×g for 1 hour) separates membrane fractions containing the expressed nuoA protein.

  • Detergent solubilization: Screening of detergents is critical, with n-dodecyl-β-D-maltoside (DDM), LDAO, or digitonin at 1-2% concentrations typically effective for nuoA solubilization from membranes.

  • Purification workflow:

    • IMAC (Immobilized Metal Affinity Chromatography) with Ni-NTA columns as the primary capture step

    • Size exclusion chromatography (SEC) to remove aggregates and achieve final purification

    • Optional ion exchange chromatography for removal of specific contaminants

  • Buffer optimization: Maintaining 0.02-0.05% detergent in all purification buffers is essential to prevent protein aggregation. Addition of glycerol (10%) and reducing agents helps maintain protein stability .

How can researchers verify the structural integrity and activity of purified recombinant nuoA?

Verification of properly folded and functional recombinant nuoA can be achieved through:

Structural Assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

  • Limited proteolysis to assess proper folding (properly folded membrane proteins show resistance to proteolytic digestion at specific sites)

  • Thermal shift assays to determine protein stability

Functional Assays:

  • NADH:ubiquinone oxidoreductase activity using artificial electron acceptors like ferricyanide or decylubiquinone

  • Reconstitution into liposomes followed by proton-pumping assays using pH-sensitive dyes

  • Oxygen consumption measurements in reconstituted systems

Quality Control Benchmarks:

  • NADH oxidation rate >1 μmol/min/mg for functional complex

  • Thermal stability with Tm >40°C indicating proper folding

  • Homogeneity >90% as assessed by SEC and SDS-PAGE analysis

How does the nuoA from C. Pelagibacter ubique compare structurally and functionally to equivalent subunits in other bacteria?

Comparative analysis reveals important differences between nuoA from C. Pelagibacter ubique and equivalent subunits in other bacteria:

Structural Comparisons:

FeatureC. Pelagibacter ubique nuoAE. coli nuoAThermus thermophilus nuoA
Size127 amino acids (streamlined)147 amino acids136 amino acids
Transmembrane helices333
Conserved residues~60% of core residues conservedReference~70% similarity to reference
Unique featuresExtended N-terminus with specialized binding motifStandard structureHeat-stable modifications

What approaches can be used to study nuoA in the context of complete Complex I assembly and function?

Studying nuoA in the context of the complete Complex I requires sophisticated techniques:

  • Heterologous co-expression systems: Expressing multiple subunits simultaneously in E. coli or yeast expression systems using polycistronic constructs or multiple compatible plasmids.

  • Pull-down assay strategy: Using tagged nuoA as bait to identify interacting partners and assembly intermediates. This approach has revealed that nuoA typically associates early with nuoJ and nuoK in the assembly pathway.

  • Cryo-EM analysis: Single-particle cryo-electron microscopy of the partially or fully assembled complex can reveal the structural context of nuoA within the membrane arm.

  • In vivo complementation: Testing the ability of C. Pelagibacter ubique nuoA to complement nuoA-deficient strains of model organisms like E. coli provides functional insights into its compatibility with other complex I components.

  • Native mass spectrometry: For detecting subcomplexes and intermediate assemblies, enabling the mapping of the assembly pathway and stoichiometry of the components .

How might recombinant nuoA be used in synthetic biology applications?

Recombinant nuoA from C. Pelagibacter ubique offers several promising applications in synthetic biology:

  • Minimal respiratory systems: The streamlined nature of C. Pelagibacter ubique's respiratory complexes makes them attractive components for designing minimal synthetic cells with efficient energy generation systems.

  • Bioenergetic optimization: Incorporating the energy-efficient respiratory components from C. Pelagibacter ubique into industrial microorganisms could enhance their performance under nutrient-limited conditions.

  • Environmental biosensors: Engineered systems incorporating nuoA with reporter genes could serve as biosensors for monitoring ocean health and nutrient cycles, given the protein's adaptation to marine environments.

  • Therapeutic potential: Similar to the approach with Ndi1p from yeast, the nuoA component from C. Pelagibacter ubique could potentially contribute to the development of therapeutic strategies for mitochondrial complex I deficiencies, particularly if it can be engineered to function in mammalian cells .

What regulatory requirements should researchers consider when working with recombinant C. Pelagibacter ubique proteins?

Researchers working with recombinant C. Pelagibacter ubique proteins must adhere to specific regulatory frameworks:

How can researchers overcome the challenges associated with expressing recombinant proteins from AT-rich genomes like C. Pelagibacter ubique?

C. Pelagibacter ubique possesses an AT-rich genome (~70.3% AT content) which presents specific challenges for recombinant protein expression:

  • Codon optimization strategies:

    • Systematic replacement of rare codons while maintaining optimal GC content

    • Avoidance of creating internal restriction sites or regulatory sequences

    • Usage of strain-specific algorithms rather than general codon optimization

  • Expression strain selection:

    • Use of E. coli Rosetta strains that supply rare tRNAs

    • Arctic Express strains for low-temperature expression to enhance folding

    • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • mRNA stability enhancement:

    • Optimization of 5' UTR to prevent secondary structures

    • Strategic placement of stabilizing elements

    • Use of specialized vectors with translation enhancers

  • Empirical optimization protocol:

    • Small-scale expression screening across multiple conditions (temperature, induction time, media composition)

    • Western blot analysis of both soluble and membrane fractions

    • Scale-up of only the most promising conditions .

What approaches can resolve discrepancies in experimental results when working with recombinant nuoA?

When facing inconsistent results with recombinant nuoA, researchers should implement a systematic troubleshooting approach:

  • Expression verification discrepancies:

    • Compare detection methods (Western blot vs. mass spectrometry)

    • Verify antibody specificity using appropriate controls

    • Check for proteolytic degradation during sample preparation

  • Activity assay interpretation:

    • Normalize activity to confirmed protein quantity

    • Evaluate buffer conditions that might affect activity (pH, ionic strength)

    • Consider contaminating activities from host proteins

  • Reproducibility enhancement framework:

    • Establish standard operating procedures with precise conditions

    • Document batch-to-batch variation in protein preparations

    • Implement quality control checkpoints throughout the purification process

  • Cross-validation strategy:

    • Apply multiple orthogonal techniques to confirm findings

    • Test activity under different assay conditions

    • Compare results with literature values for related proteins .

What are the current limitations in understanding nuoA function in C. Pelagibacter ubique?

Current knowledge gaps regarding nuoA function in C. Pelagibacter ubique include:

  • Structural characterization: The high-resolution structure of nuoA from C. Pelagibacter ubique has not been determined, limiting our understanding of its precise molecular mechanism.

  • Redox partner interactions: The specific interactions between nuoA and other complex I subunits remain incompletely characterized, as do interactions with native quinones in the marine environment.

  • Regulatory mechanisms: How expression of nuoA is regulated in response to environmental conditions (light, nutrient availability, oxygen levels) is not fully understood, though some evidence suggests differential regulation in light versus dark conditions .

  • Bioenergetic efficiency: Quantitative measurements of proton translocation efficiency and ATP yield in C. Pelagibacter ubique are lacking, making it difficult to determine if its respiratory complexes are more efficient than those of other bacteria.

  • Interspecies variation: The degree of functional variation in nuoA among different strains of SAR11 bacteria remains to be systematically investigated .

How might high-throughput approaches advance research on recombinant C. Pelagibacter ubique proteins?

High-throughput approaches offer significant potential for advancing research on C. Pelagibacter ubique proteins:

  • Parallel expression screening:

    • Microplate-based expression optimization across multiple variables

    • Automated purification systems for rapid screening of conditions

    • Fluorescence-based folding reporters for real-time monitoring

  • Structural genomics pipeline integration:

    • Automated construct design with varying fusion partners and truncations

    • High-throughput crystallization screening

    • Fragment-based screening for structure stabilization

  • Functional characterization platforms:

    • Microfluidic systems for enzyme kinetics under varied conditions

    • Biosensor arrays for detecting interaction partners

    • Droplet-based assays for activity screening in different environments

  • Computational acceleration:

    • Machine learning algorithms for predicting optimal expression conditions

    • Molecular dynamics simulations to predict functional properties

    • Systems biology models incorporating nuoA function within metabolic networks .

How does recombination in C. Pelagibacter ubique potentially impact the genetic diversity of nuoA genes in marine environments?

The impact of recombination on nuoA genetic diversity in marine C. Pelagibacter ubique populations is significant and multifaceted:

  • High recombination rates: Research has demonstrated that C. Pelagibacter ubique exhibits exceptionally high intraspecific recombination rates (ρ) that exceed point mutation rates (θ) as a source of genetic diversity. This suggests that nuoA genes in natural populations may show greater variation than would be expected from mutation alone .

  • Breakdown of linkage disequilibrium: Studies have shown extensive evidence for widespread breakdown of linkage disequilibrium in C. Pelagibacter ubique populations, suggesting that nuoA variants can be exchanged independently of other genomic regions, potentially accelerating adaptation .

  • Mechanism and environmental triggers: Under starvation conditions, C. Pelagibacter ubique appears to express pili and upregulate recA and xerD genes involved in recombination and DNA repair, which could facilitate the exchange of genetic material including nuoA variants in nutrient-limited environments .

  • Evolutionary implications: The high recombination rates in natural C. Pelagibacter ubique populations suggest that these bacteria may follow a population genetic structure more akin to sexually interbreeding eukaryotes than to clonal bacterial populations, with alleles for genes like nuoA being shared across a common pool .

  • Practical research considerations: The high genetic diversity resulting from recombination means that researchers should consider using multiple strains when studying nuoA function to capture the natural variation present in marine environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.