Recombinant Pelargonium hortorum Ethylene receptor 1 (ETR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ETR1; Ethylene receptor 1; PhETR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-740
Protein Length
full length protein
Species
Pelargonium hortorum (Common geranium)
Target Names
ETR1
Target Protein Sequence
MEACNCFEPQWPADDLLMKYQYISDFFIAVAYFSIPLELIYFVKKSAVFPYKWVLVQFGA FIVLCGATHLINLWTFNLHTRTVEIVMTTAKLMTAAVSCVTALMLVHIIPDLLSVKTREL FLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLGLEECA LWMPTRTGLELQLSHTLRQQNPVGYTVPIHLPVLNQVFSSNRAIKISPNSPIARLRPLAG KYVPGEVVAVRVPLLHLSNFQINDWPELSTKRYAMMVLMLPSDSARQWHVHELELVEVVA DQVAVALSHAAILEESMRARDLLMEQNVALDMARREAETAIRARNDFLAVMNHEMRTPMH AIIALSSLLQETDLTSEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDIATFNLH AVFRQVFNLIKPIASVKKLFITLNVSPDLPEYVIGDEKRLVQIMLNVVGNAVKFSKEGII SVTAFVAKSESVRDPRAPDFFPVSSDNQFYMRVQVKDSGSGINPQDMPKLFTKFAQSQPV ATKNSGGSGLGLAISKRFVNLMDGHIWIDSEGPSKGCTVTFVVKLGIPEGSNEPKLPLMP KVSANNSQTDFPGLKVLLMDENGISRMVTKGLLMHLGCDVTSVSSSEECLRMVSQDHKVV FMDVRVPGLDGHELAVRIHEKFMKRHERPLIVALTSNADKVTKENCLRVGMEGVILKPVS VDKMRNVLSKLLEHRILFEA
Uniprot No.

Target Background

Function
This protein may play an early role in ethylene signal transduction, potentially functioning as an ethylene receptor or a pathway regulator.
Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Pelargonium hortorum Ethylene Receptor 1 (PhETR1) and how does it relate to other ethylene receptors?

PhETR1 is an ethylene receptor isolated from Pelargonium hortorum (common geranium) that shares significant homology with other plant ethylene receptors. Sequence analysis reveals that the deduced amino acid sequence of PhETR1 shares 78% identity with ETR1 from Arabidopsis thaliana, indicating conservation of this important signaling component across plant species . PhETR1 belongs to a multigene family of ethylene receptors that collectively regulate plant responses to the phytohormone ethylene.

What is the expression pattern of PhETR1 in different plant tissues?

Gene expression analysis has demonstrated that PhETR1 is expressed at varying levels in different geranium tissues. The receptor shows moderate expression in leaves, pedicels, sepals, pistils, and petals, while expression in roots is notably lower . This tissue-specific expression pattern suggests differential regulation of ethylene sensitivity across plant organs, potentially contributing to tissue-specific ethylene responses.

Tissue TypePhETR1 Expression Level
LeavesModerate
PedicelsModerate
SepalsModerate
PistilsModerate
PetalsModerate
RootsVery low

How does the expression of PhETR1 change during floral development?

Interestingly, PhETR1 mRNAs are expressed in geranium florets long before they become receptive to pollination, and transcript levels remain relatively constant throughout floral development . This developmental stability differs from the pattern observed in some other ethylene receptors, which show more dynamic expression changes during development.

How does PhETR1 contribute to ethylene perception and signaling in Pelargonium?

PhETR1 functions as a membrane-bound receptor that detects the presence of ethylene gas. While sharing functional conservation with other ethylene receptors, studies indicate that the amount of PhETR1 mRNA is not necessarily indicative of the level of sensitivity of geranium florets to ethylene . This suggests complex post-transcriptional or post-translational regulation of receptor activity or downstream signaling components.

What is the relationship between PhETR1 expression and ethylene sensitivity during pollination and abscission?

Research has shown that message levels of PhETR1 in pistils and receptacles remain unaffected by both self-pollination and treatment with 1 micro/l ethylene that induces petal abscission . This finding indicates that regulatory changes in ethylene sensitivity during these processes likely occur through mechanisms other than altered receptor expression, possibly involving protein modifications or changes in downstream signaling components.

How do ethylene receptors like PhETR1 collaborate in signal transduction?

Recent findings suggest that different combinations of ethylene receptors can facilitate differential receptor signal output, thus regulating ethylene activity . Ethylene receptors form protein complexes to relay signals according to specific cellular environments and responses . This collaborative signaling mechanism may explain how plants achieve precise regulation of diverse ethylene-mediated processes despite having a limited number of receptor types.

What expression systems are available for producing recombinant Pelargonium hortorum ETR1?

Recombinant Pelargonium hortorum ETR1 can be produced in multiple heterologous expression systems, each with distinct advantages for different research applications:

Expression SystemProduct Code ExampleSpecial Features
YeastCSB-YP894512PEI1Post-translational modifications
E. coliCSB-EP894512PEI1High yield, economical
E. coli (Biotinylated)CSB-EP894512PEI1-BIn vivo biotinylation via AviTag-BirA technology
BaculovirusCSB-BP894512PEI1Insect cell expression
Mammalian cellCSB-MP894512PEI1Native-like folding and modifications

The choice of expression system depends on specific research requirements, including whether post-translational modifications are needed and the intended downstream applications .

What purification and reconstitution methods are recommended for recombinant PhETR1?

Recombinant PhETR1 is typically provided as a lyophilized powder with purity >85% as determined by SDS-PAGE . For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • The default final concentration of glycerol is typically 50%

Researchers should be aware that different tagging systems may be employed during production, which can affect purification strategies and downstream applications.

How can comparative analysis of PhETR1 and PhETR2 advance understanding of receptor specificity?

Pelargonium hortorum contains at least two ethylene receptors, PhETR1 and PhETR2, which share 78% and 79% identity with Arabidopsis ETR1 respectively . Comparative functional analysis of these closely related receptors can reveal:

  • Receptor-specific roles in different tissues or developmental stages

  • Structural determinants of ligand binding specificity

  • Differential interactions with downstream signaling components

Such studies could employ techniques including receptor-specific antibodies, domain-swapping experiments, and selective gene silencing to dissect the unique contributions of each receptor.

How does ethylene receptor function vary in interspecific Pelargonium hybrids?

Interspecific hybridization studies involving Pelargonium × hortorum and related species have revealed complex genetic interactions that may affect ethylene receptor function. Research has demonstrated that when creating hybrids between different Pelargonium species, diverse cyto-nuclear incompatibilities can emerge that may involve organellar function . These natural genetic variations provide an excellent system for studying how ethylene receptor diversity contributes to adaptation and speciation.

What advanced molecular techniques are most effective for studying PhETR1 protein-protein interactions?

To investigate protein-protein interactions involving PhETR1, researchers can employ several complementary approaches:

  • In vivo biotinylation using AviTag technology: Recombinant PhETR1 can be produced with in vivo biotinylation using E. coli biotin ligase (BirA), which specifically attaches biotin to the AviTag peptide . This allows for streptavidin-based pull-down assays to identify interacting partners.

  • Yeast-two-hybrid screening: Using partial or full-length PhETR1 as bait to screen for interacting proteins from Pelargonium cDNA libraries.

  • Co-immunoprecipitation with mass spectrometry: To identify native protein complexes containing PhETR1 in plant tissues.

  • Bimolecular fluorescence complementation (BiFC): For visualizing protein interactions in plant cells.

What are the challenges in correlating PhETR1 transcript levels with ethylene sensitivity?

Research has demonstrated that the amount of PhETR1 mRNA is not indicative of the level of sensitivity of geranium florets to ethylene . This presents several methodological challenges:

  • Protein levels may not correspond to transcript levels due to post-transcriptional regulation

  • Receptor activity may be modulated by post-translational modifications

  • Changes in downstream signaling components could alter ethylene sensitivity without affecting receptor expression

  • Receptor turnover rates may vary in different tissues or conditions

Researchers should employ multiple approaches, including protein-level analyses and functional assays, to comprehensively characterize ethylene sensitivity.

How should experiments be designed to investigate PhETR1 function during floral development and senescence?

When designing experiments to study PhETR1 function during floral development and senescence, researchers should consider:

  • Temporal resolution: Since PhETR1 transcripts are present long before florets are receptive to pollination , experiments should include multiple time points throughout floral development.

  • Treatment controls: Include appropriate controls for ethylene treatments (e.g., 1 micro/l ethylene for inducing petal abscission) .

  • Tissue specificity: Analyze receptor function in specific floral organs separately (pistils, petals, sepals) as they may have different sensitivities.

  • Environmental variables: Controlling temperature is critical as ambient temperature can severely affect the expression of chlorosis and potentially other ethylene-mediated responses .

  • Genetic approaches: Consider using comparative analyses of different Pelargonium species or hybrids that exhibit variation in floral development or senescence characteristics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.