Recombinant Pelargonium hortorum Ethylene receptor 2 (ETR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ETR2; Ethylene receptor 2; PhETR2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-741
Protein Length
full length protein
Species
Pelargonium hortorum (Common geranium)
Target Names
ETR2
Target Protein Sequence
MESCNCIEPQWPADELLMKYQYISDFFIAIAYFSIPLELIYFVKKSAVFPYRWVLVQFGA FIVLCGATHLINLWTFNMHSKTVEIVMTTAKIMTAVVSCATALMLVHIIPDLLSVKTREL FLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECA LWMPTRTGLELQLSYTLRQQNPVGFTVPIHLPVINQVFSSNHAIKISPNSPIARLRPIAG KYMPGEVVGVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA DQVAVALSHAAILEESMRARDLLMEQNVALDMARREAETAIRARNDFLAVMNHEMRTPMH AIIALSSLLQETELTPEQRLMVETVLKSSNLLATLINDVLDLSRLEDGSLQLDIGTFNLH ALLREVHNLIKPIASVKKLCISLNVATDLPEYAVGDEKRLVQIILNVVGNAVKFSKEGNI SITAFVAKSESLRDPRAPDFFPICGENQFYLRVQVKDSGLGINPQDIPRLFTKFAQTQPV ATKNSGGSGLGLAICKRFVNLMEGHIWIDSEGPGKGCTATFVVKLGIPERSSEPKLLLMP KVPANHGQTNFSGLKVLLLDDNGVSRAVTRGLLAHLGCDVTTVSSSDELLRVVSQDYKVV FMDVCMPEVDGFEIAVRIHEKFMTRHERPLIVALTGNIDQVTKDNCTRVGMEGVVLKPVS IDKMRNVLSNLLEHRVLFEAI
Uniprot No.

Target Background

Function
This protein may play an early role in the ethylene signal transduction pathway, potentially functioning as an ethylene receptor or a pathway regulator.
Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Pelargonium hortorum ETR2 and how does it compare to ETR2 in model plants?

Pelargonium hortorum ETR2 belongs to the subfamily-2 ethylene receptors that share a conserved modular structure consisting of three transmembrane domains near the N-terminus, followed by a GAF domain, and signal output motifs in the C-terminal half. The transmembrane domains contain the ethylene-binding site and are responsible for localization to the endoplasmic reticulum . Unlike subfamily-1 receptors (ETR1 and ERS1), the subfamily-2 receptors including ETR2 lack the necessary residues for histidine-kinase activity and instead function as serine/threonine kinases . The GAF domain facilitates protein-protein interactions that may mediate the formation of higher-order receptor clusters .

How does ETR2 function within the ethylene signaling pathway in Pelargonium?

ETR2 functions as a negative regulator of ethylene responses in conjunction with the Raf-like kinase CTR1 . In the absence of ethylene, ETR2 and other receptors activate CTR1, which suppresses downstream ethylene responses . Upon ethylene binding to ETR2's transmembrane domains, conformational changes occur that lead to inactivation of CTR1 and consequent activation of the ethylene response pathway . Interestingly, ETR2 is also subject to ethylene-induced degradation, creating a feedback mechanism that may fine-tune ethylene sensitivity .

How do interactions between ETR2 and CTR1 affect ethylene signaling dynamics?

The interaction between ETR2 and CTR1 is crucial for modulating ethylene responses. CTR1 interacts with multiple members of the receptor family, though it shows stronger interactions with receptors containing a receiver domain . Membrane-associated CTR1 levels change in response to ethylene, correlating with ethylene-mediated changes in receptor levels including ETR2 .

While direct ETR2-CTR1 interactions have been less extensively characterized than ETR1-CTR1 interactions, weak interactions between ETR2 and CTR1 have been observed in two-hybrid analysis . These interactions appear to serve dual purposes: CTR1 functions as a negative regulator of ethylene signaling when activated by the receptors, and the physical interaction may also protect receptors like ETR2 from ethylene-induced turnover, as demonstrated with ETR1 .

What role does ETR2 play in interspecific hybrids of Pelargonium species?

In interspecific hybridization studies involving Pelargonium × hortorum and related species, nuclear-encoded proteins like ETR2 can play critical roles in cyto-nuclear compatibility . The segregation patterns observed in F1 and F2 interspecific hybrids indicate that nuclear genes regulate organelle function, potentially including ethylene signaling components . While not specifically focused on ETR2, research on Pelargonium interspecific hybrids suggests that understanding nuclear-encoded organellar proteins may be key to developing new cultivars that incorporate desirable traits from wild relatives while maintaining proper signaling function .

What are the optimal strategies for cloning and recombinant expression of Pelargonium hortorum ETR2?

When cloning Pelargonium ETR2, researchers should follow similar approaches to those used for other plant ethylene receptors. The recommended method involves:

  • RNA extraction from appropriate tissue (preferably young leaves or floral tissues where ETR2 is expressed at moderate levels)

  • cDNA synthesis using oligo(dT) primers

  • PCR amplification using primers designed to the conserved regions of ETR2

  • Cloning into appropriate vectors such as pSalI for expression studies

For recombinant expression, several systems have proven effective:

  • Expression in yeast systems for protein-protein interaction studies

  • Plant expression vectors for complementation studies in Arabidopsis etr2 mutants

  • Bacterial expression systems for biochemical characterization

The choice of expression system should be guided by specific experimental goals, with plant-based systems being preferred for functional studies due to the membrane-bound nature of ETR2 .

What techniques are most effective for analyzing ETR2 protein levels and degradation kinetics?

For analyzing ETR2 protein levels and degradation kinetics, researchers should employ a multi-faceted approach:

  • Protein Extraction and Membrane Fractionation: Since ETR2 is membrane-localized to the endoplasmic reticulum, proper membrane fractionation is essential .

  • Western Blot Analysis: Using antibodies specific to ETR2 or epitope tags if using recombinant proteins.

  • Pulse-Chase Experiments: To determine protein half-life and degradation rates.

  • Pharmacological Treatments:

    • Proteasome inhibitors (e.g., MG132) to confirm proteasome-dependent degradation

    • Cycloheximide to block protein synthesis and isolate degradation processes

    • Brefeldin A to assess subcellular localization requirements for degradation

  • Ethylene Dose-Response and Time-Course Analyses: Treating samples with varying ethylene concentrations (0.1-100 μl/liter) and measuring protein levels at different time points (1-24 hours) to establish degradation kinetics .

How can functional assays be designed to assess ETR2 activity in ethylene signaling?

Functional assays for ETR2 should address both binding capacity and signaling activity:

  • Ethylene Binding Assays: Using radiolabeled ethylene or competition assays with ethylene analogs to measure binding affinity and kinetics.

  • Complementation Studies: Expressing Pelargonium ETR2 in Arabidopsis etr2 mutants to assess functional conservation.

  • Protein-Protein Interaction Assays:

    • Co-immunoprecipitation to detect ETR2-CTR1 interactions

    • Yeast two-hybrid assays for mapping interaction domains

    • BiFC (Bimolecular Fluorescence Complementation) for visualizing interactions in planta

  • Ethylene Response Phenotyping: Measuring classic ethylene responses such as:

    • Triple response in etiolated seedlings

    • Flower senescence timing

    • Fruit ripening parameters

    • Abscission rates of floral organs1

  • Reporter Gene Assays: Using ethylene-inducible promoters fused to reporter genes to quantify signaling output.

How should researchers address discrepancies between ETR2 transcript and protein levels in experimental data?

Researchers investigating ETR2 should be aware that transcript and protein levels may not correlate directly due to post-transcriptional regulation mechanisms . To address this challenge:

  • Always measure both transcript and protein levels in parallel experiments when studying ETR2 regulation.

  • Design time-course experiments that capture the dynamic relationship between transcription and protein accumulation/degradation.

  • Consider protein stability factors by using protein synthesis inhibitors like cycloheximide to dissociate transcription-related effects from post-translational regulation .

  • Examine translational efficiency using polysome profiling to determine if translational control contributes to observed discrepancies.

  • Quantify relative contributions of transcriptional induction versus protein degradation at different ethylene concentrations:

Ethylene ConcentrationPrimary Regulatory MechanismObservable Effect
0-0.1 μl/literBasal expressionStable ETR2 levels
0.1-1 μl/literTranscriptional inductionIncreased ETR2 protein
>1 μl/literPost-transcriptional degradationDecreased ETR2 despite stable transcript

This approach will provide a more complete understanding of the regulatory mechanisms controlling ETR2 levels under various conditions .

What factors should be considered when designing experiments to study ETR2 in interspecific Pelargonium hybrids?

When studying ETR2 in interspecific Pelargonium hybrids, researchers should consider:

How can researchers distinguish between direct effects on ETR2 function versus indirect effects on the ethylene signaling pathway?

Distinguishing direct from indirect effects on ETR2 function requires carefully designed experiments:

  • Domain-specific mutations: Create targeted mutations in different ETR2 domains to separate binding, localization, and signaling functions.

  • Chimeric receptor analysis: Construct chimeric receptors combining domains from different receptor family members to identify functional specificities.

  • Genetic background considerations: Test ETR2 function in various genetic backgrounds, including:

    • Wild-type plants

    • Single receptor mutants (etr1, ers1, etc.)

    • Higher-order receptor mutants

    • ctr1 mutants to assess CTR1-independent functions

  • Parallel analysis of multiple receptors: Compare effects on ETR2 with effects on other family members to identify receptor-specific versus pathway-general phenomena.

  • Biochemical validation: Confirm direct interactions and modifications using in vitro systems with purified components whenever possible.

What are the most promising approaches for studying ETR2 post-translational modifications in Pelargonium?

Future research on ETR2 post-translational modifications should focus on:

  • Mass spectrometry-based approaches: To identify phosphorylation, ubiquitination, SUMOylation, and other modifications on ETR2.

  • Site-directed mutagenesis: To create modification-resistant ETR2 variants for functional studies.

  • Proteomic time-course analysis: To track changes in the ETR2 modification landscape during ethylene response.

  • Identification of E3 ligases: To determine the specific ubiquitin ligases responsible for ethylene-induced ETR2 degradation .

  • Comparison across Pelargonium species: To determine whether differences in post-translational regulation contribute to species-specific ethylene responses.

How might CRISPR/Cas9 genome editing be applied to study ETR2 function in Pelargonium hortorum?

CRISPR/Cas9 genome editing offers powerful approaches to ETR2 research:

  • Creation of etr2 knockout lines: To assess the specific contribution of ETR2 to ethylene signaling in Pelargonium.

  • Domain-specific mutations: To generate plants with specific alterations in ethylene binding, CTR1 interaction, or degradation motifs.

  • Promoter editing: To modify ETR2 expression patterns without altering protein sequence.

  • Endogenous tagging: To introduce epitope or fluorescent tags at the native locus for more accurate tracking of ETR2 dynamics.

  • Allele replacement: To substitute ETR2 variants from different Pelargonium species to test functional conservation and specificity.

What potential roles might ETR2 play in developing ethylene-resistant ornamental Pelargonium varieties?

ETR2 manipulation holds promise for developing ethylene-resistant ornamental varieties:

  • Engineered degradation resistance: Modifying ETR2 degradation motifs could maintain ethylene signaling repression even under high ethylene conditions .

  • Expression level optimization: Adjusting ETR2 expression levels could fine-tune ethylene sensitivity for specific applications.

  • Interspecific transfer of ETR2 variants: Introducing naturally occurring ETR2 variants from ethylene-insensitive Pelargonium species could improve postharvest longevity .

  • Ethylene binding site modifications: Creating variants with altered binding kinetics could produce plants with customized ethylene response thresholds.

  • Co-engineering of receptor-CTR1 interactions: Enhancing ETR2-CTR1 interactions could stabilize the receptor complex and maintain signal repression under typically inductive conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.