Recombinant Pelobacter carbinolicus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pelobacter carbinolicus NADH-quinone Oxidoreductase Subunit A (NuoA)

Pelobacter carbinolicus NADH-quinone oxidoreductase subunit A (NuoA) is a component of the NADH:quinone oxidoreductase I (NDH-1) complex, an enzyme that catalyzes the transfer of electrons from NADH to quinones in the respiratory chain . This process is crucial for energy generation in bacteria, as it establishes a proton electrochemical gradient across the cytoplasmic membrane .

Biological Function and Significance

NADH-quinone oxidoreductase subunit A (NuoA) is involved in oxidoreductase activity, specifically acting on NADH or NADPH . The NDH-1 complex, which includes NuoA, plays a vital role in bacterial respiration .

Key Functions:

  • Electron Transport: NDH-1 transfers electrons from NADH to quinones via FMN and iron-sulfur (Fe-S) centers .

  • Proton Translocation: The redox reaction is coupled to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, conserving redox energy in a proton gradient .

  • Energy Generation: By generating a proton electrochemical gradient, NDH-1 contributes to the cell's energy production .

  • Anaerobic Respiration: NDH-1 is essential for anaerobic respiration, utilizing fumarate or DMSO as terminal electron acceptors and transferring electrons to menaquinone .

Functional Insights from E. coli Homologs

The E. coli NDH-1 complex, which includes NuoA, has been extensively studied, providing insights into the function of NuoA in Pelobacter carbinolicus .

Key Findings from E. coli Studies:

  • Electrogenic Proton Pump: NDH-1 functions primarily as an electrogenic proton pump, with possible secondary Na+/H+ antiport activity .

  • Subunit Interactions: Subunits like NuoCD interact with flagellar motor components, indicating a role in cellular processes beyond energy production .

Biotechnological and Research Applications

Recombinant NuoA proteins are valuable in research for understanding bacterial respiration and energy metabolism. They can be used in structural studies, enzyme assays, and to investigate the NDH-1 complex's role in various bacterial species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Pcar_0205; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1)
Target Names
nuoA
Target Protein Sequence
MVSEHISTQQVGPDALFSPLGWDLLALALYVALACIIVVSLLLAARFLGHRSRTPLKNLP YECGVEPTGPARPGYPVPFYLTAIFFVVFDVEVAFIASWAVAYDLLGWAGLAQIAFFIIT LLVALIYLWRRGALDWGPQRR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediate electron carriers. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thus conserving redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the NADH:quinone oxidoreductase in P. carbinolicus compare to similar enzymes in other bacteria?

NADH:quinone oxidoreductase in P. carbinolicus shares functional similarities with those found in other bacteria but has specific adaptations related to the organism's unique metabolism. Unlike some other bacterial species, P. carbinolicus is strictly anaerobic and can ferment substrates such as ethanolamine, ethanol, and propanediol into acetate and H2 or formate when grown syntrophically with a partner .

In comparative terms, NADH:quinone oxidoreductases across bacterial species maintain the core function of electron transfer while exhibiting species-specific variations. For example, in halotolerant bacteria like Ba1, the NADH:quinone oxidoreductase activity is specifically increased by sodium ions, which affect the semiquinone reduction step in the electron transfer process . The P. carbinolicus enzyme likely has adaptations specific to its anaerobic lifestyle and metabolic requirements.

What are the structural characteristics of nuoA in respiratory Complex I?

NuoA is characterized as a small membrane-bound subunit of respiratory Complex I. In structural studies of mycobacterial Complex I, researchers noted that certain subunits including NuoH and NuoJ have extended sequences at their N or C termini compared to corresponding subunits in Complex I from other species . While not specifically describing nuoA, this research indicates that bacterial Complex I subunits can have species-specific structural features that affect their function and interaction with other components of the complex.

The membrane-bound nature of nuoA presents specific challenges for structural characterization, which is why it is often missing or difficult to detect in protein preparations of Complex I . Its hydrophobic properties require specialized techniques for isolation and study.

What expression systems are most effective for recombinant production of P. carbinolicus nuoA?

While the search results don't specifically address recombinant production of P. carbinolicus nuoA, research on related systems provides valuable methodological insights. Heterologous expression in Escherichia coli has been successfully demonstrated for other P. carbinolicus genes including the acetoin dehydrogenase enzyme system components (acoA, acoB, acoC, acoL, and acoS) , suggesting that E. coli could potentially serve as a suitable host for nuoA expression.

For membrane proteins like nuoA, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) might be more effective. Expression should be optimized by testing different induction conditions, temperatures, and media compositions to maximize protein yield while maintaining proper folding.

What are the challenges in purifying recombinant nuoA from P. carbinolicus?

Purification of small membrane subunits like nuoA presents several specific challenges:

  • Membrane integration: As a membrane protein, nuoA requires detergent solubilization for extraction from cellular membranes.

  • Stability concerns: Small membrane subunits are often unstable when isolated from their native complex.

  • Detection difficulties: Small membrane proteins can be harder to detect and quantify during purification steps.

Research on mycobacterial Complex I showed that nuoA was the only expected subunit not detected in their purified complex , highlighting the difficulty in maintaining this subunit during purification procedures. Buffer optimization is crucial, with research indicating that pH 6.0 may be optimal for Complex I stability, similar to findings with E. coli and T. thermophilus Complex I .

What tagging strategies can improve recombinant nuoA purification yield?

Research on mycobacterial Complex I found that a C-terminal 3×FLAG tag attached to the NuoH subunit provided optimal results for complex stability and purification . For nuoA specifically, similar C-terminal tagging approaches could be effective, although the small size of nuoA might necessitate careful tag selection to avoid interfering with protein folding or function.

A methodological approach would involve testing multiple tagging strategies:

  • C-terminal vs. N-terminal tags

  • Different tag types (His, FLAG, Strep, etc.)

  • Tag placement with respect to potential transmembrane domains

Table 1: Comparison of Tagging Strategies for Membrane Protein Purification

Tag TypeAdvantagesDisadvantagesBest Application
PolyhistidineHigh affinity for metal ions, small sizePotential metal ion interferenceInitial purification
FLAGHigh specificity, mild elutionMore expensive antibodiesWhen high purity is required
Strep-tagGentle elution, high purityLower capacityFunctional studies

What assays can be used to measure NADH:quinone oxidoreductase activity in recombinant P. carbinolicus preparations?

Based on research with mycobacterial Complex I, NADH:quinone oxidoreductase activity can be assayed using different electron acceptors such as decylubiquinone (dQ) or menadione (MD) . The enzymatic activity is typically measured spectrophotometrically by monitoring the decrease in NADH absorbance at 340 nm.

A methodological approach to activity measurement would include:

  • Prepare reaction mixture containing buffer (optimally at pH 6.0 for Complex I stability)

  • Add purified enzyme preparation

  • Add electron acceptor (decylubiquinone or menadione)

  • Initiate reaction by adding NADH

  • Monitor decrease in absorbance at 340 nm

  • Calculate specific activity (μmol/min/mg protein)

Mycobacterial Complex I displayed specific activity of approximately 5 μmol/min/mg with either quinone species , which provides a reference point for expected activity levels in bacterial NADH:quinone oxidoreductase preparations.

How can researchers distinguish between nuoA-dependent and independent NADH oxidation activities?

To distinguish between nuoA-dependent and independent activities, researchers can employ several approaches:

What factors influence the stability and activity of recombinant P. carbinolicus NADH:quinone oxidoreductase complexes?

Several factors significantly impact the stability and activity of NADH:quinone oxidoreductase complexes:

  • pH: Research indicates an optimum stability when buffers are adjusted to pH 6.0, similar to Complex I from E. coli and T. thermophilus .

  • Detergent selection: Appropriate detergent is crucial for maintaining membrane protein stability while solubilizing the complex from lipid membranes.

  • Salt concentration: Ionic strength can affect complex stability and activity, with sodium specifically shown to increase NADH oxidation rates in some bacterial systems .

  • Reducing agents: Maintaining the redox state of critical cysteine residues may be important for activity.

  • Temperature: Lower temperatures often enhance stability but may reduce activity.

How can mutagenesis of nuoA inform our understanding of Complex I assembly and function in P. carbinolicus?

Site-directed mutagenesis of nuoA can provide valuable insights into structure-function relationships within Complex I. Specifically:

  • Transmembrane domain mutations can reveal the importance of membrane anchoring for complex stability.

  • Mutations at conserved residues can identify critical functional sites.

  • Chimeric constructs with nuoA from other species can reveal species-specific adaptations.

How does the energy-transducing mechanism of P. carbinolicus Complex I compare with other bacterial NADH:quinone oxidoreductases?

The energy-transducing mechanism of NADH:quinone oxidoreductase involves coupling electron transfer to proton translocation across the membrane. In some bacterial systems, like the halotolerant bacterium Ba1, sodium ions specifically increase the rate of NADH oxidation, with the site of this sodium effect identified at the NADH:quinone oxidoreductase .

In Ba1, sodium accelerates quinone reduction but does not affect quinol oxidation with oxygen as the terminal electron acceptor . The sodium-dependent pathway of quinone reduction exhibits higher apparent affinity to extraneous quinone (Q-2) than the sodium-insensitive pathway and is specifically inhibited by 2-heptyl-4-hydroxyquinoline N-oxide .

For P. carbinolicus specifically, the role of nuoA in energy transduction would require detailed electrophysiological and biochemical studies. A methodological approach would involve:

  • Reconstituting purified complexes into liposomes

  • Measuring proton (or potentially ion) translocation using pH-sensitive dyes or electrodes

  • Comparing wild-type complexes with those containing modified nuoA

What strategies can overcome the challenges in genetic manipulation of P. carbinolicus for nuoA studies?

  • Optimized conjugation: The most promising results in previous research came from conjugation protocols, with PCR screening indicating incorporation of plasmid into the P. carbinolicus genome, though subsequent sequencing was inconclusive . Further refinement of this approach, with careful attention to conjugation conditions, donor strains, and selection methods, might yield success.

  • Alternative transformation methods: Beyond the previously attempted electroporation, conjugation, and natural transformation methods , newer techniques like CRISPR-Cas delivery systems might prove effective.

  • Heterologous expression: Expressing P. carbinolicus nuoA in genetically tractable relatives from the Geobacteraceae family could provide a compromise approach.

  • In vitro reconstitution: Expressing individual components in E. coli and reconstituting functional complexes in vitro, as has been done with other multi-subunit complexes.

How can researchers address the low expression levels of Complex I in P. carbinolicus?

Research with Mycobacterium smegmatis found that Complex I protein levels were extremely low under standard laboratory conditions but were more easily detected in bacteria grown in media without carbohydrate supplementation . Addition of glucose decreased Complex I levels more than succinate or glycerol, and anaerobic growth prevented detection of Complex I regardless of medium composition .

For P. carbinolicus, which is strictly anaerobic , optimizing expression conditions would involve:

  • Testing different carbon and energy sources: Research showed varying levels of Complex I expression depending on carbon source . For P. carbinolicus, testing various electron donors beyond the typical ethanol or hydrogen might identify conditions that upregulate Complex I.

  • Manipulating growth phase: Complex I expression may vary throughout growth phases.

  • Genetic approaches: If genetic manipulation becomes feasible, promoter engineering could enhance expression.

  • Growth in defined media: Minimal media might induce higher expression of energy-generating systems like Complex I.

What analytical techniques are most effective for detecting and quantifying nuoA in complex mixtures?

Detecting small membrane proteins like nuoA in complex mixtures presents analytical challenges. Effective approaches include:

  • Immunodetection: Using antibodies specific to nuoA for western blotting, similar to the detection of NuoC-3×FLAG by western blotting in mycobacterial research .

  • Mass spectrometry: Targeted proteomics approaches can detect and quantify specific peptides derived from nuoA, even in complex mixtures.

  • Radiolabeling: For metabolic studies, incorporating radioactive amino acids can enhance detection sensitivity.

  • Fluorescent protein fusions: If genetic manipulation becomes possible, fluorescent protein tags can aid visualization and quantification.

  • Specialized gel systems: Methods optimized for small hydrophobic proteins, such as Tricine-SDS-PAGE, might improve resolution and detection compared to standard polyacrylamide gel electrophoresis that failed to detect NuoA in mycobacterial Complex I preparations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.