Recombinant Pelobacter carbinolicus Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pelobacter carbinolicus Sec-Independent Protein Translocase Protein TatC (tatC)

The Recombinant Pelobacter carbinolicus Sec-Independent Protein Translocase Protein TatC (tatC) is a bacterial membrane protein integral to the Twin-Arginine Translocation (Tat) pathway. This system enables the transport of folded proteins across the cytoplasmic membrane, distinguishing it from the Sec pathway, which translocates unfolded substrates . The TatC protein serves as the central receptor for substrate recognition and translocon assembly in the Tat machinery . Recombinant TatC from P. carbinolicus is produced in Escherichia coli for biochemical and structural studies, enabling insights into its role in anaerobic metabolism and protein transport .

Protein Architecture

  • Gene: tatC (locus tag: Pcar_0094 in P. carbinolicus) .

  • Sequence: 250 amino acids (UniProt ID: Q3A8D5) with a predicted molecular weight of ~28 kDa .

  • Domains:

    • N-terminal transmembrane helices for membrane anchoring.

    • Cytoplasmic regions critical for substrate recognition and TatBC complex formation .

Functional Role in the Tat Pathway

  • Substrate Binding: TatC recognizes twin-arginine (RR) signal peptides on folded proteins .

  • Translocon Assembly: Collaborates with TatB to form the TatBC receptor complex, which recruits TatA for pore formation .

  • Energy Coupling: Utilizes the proton motive force (PMF) for transport, distinguishing it from ATP-dependent systems .

Table 1: Key Properties of Recombinant P. carbinolicus TatC

PropertyDetails
SourcePelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)
Expression HostEscherichia coli
TagDetermined during production (commonly His-tag)
StorageTris-based buffer with 50% glycerol; store at -20°C or -80°C
Sequence RegionFull-length (1-250 aa)

Expression Systems

Recombinant TatC is expressed in E. coli with codon optimization for high yield. The protein is purified via affinity chromatography (e.g., His-tag) and validated using SDS-PAGE (>90% purity) .

Biochemical Validation

  • Activity Assays: Confirmation of TatC function in substrate binding using synthetic RR-signal peptides .

  • Structural Studies: Blue Native-PAGE (BN-PAGE) reveals TatC forms stable homomultimeric complexes (e.g., heptamers) and interacts with TatB in detergent-solubilized membranes .

Mechanistic Insights

  • Translocon Dynamics: Studies demonstrate TatC’s PMF-dependent interaction with TatA during substrate transport .

  • Substrate Discrimination: TatC ensures only properly folded proteins are translocated, preventing periplasmic misfolding .

Biotechnological Relevance

  • Pathogen Targeting: TatC homologs in pathogens like Pseudomonas aeruginosa are explored as drug targets due to their role in virulence .

  • Industrial Enzymes: Enables export of cofactor-containing enzymes (e.g., hydrogenases) for bioenergy applications .

Table 2: Comparative Analysis of TatC Across Species

OrganismTatC Homolog FeaturesFunctional Role
Escherichia coliForms TatBC complex; essential for substrate proofreading Anaerobic respiration, metal homeostasis
P. carbinolicus250-aa sequence; conserved RR-binding domain Anaerobic metabolism, cytochrome biogenesis
Halobacterium sp.TatC-B subcomplexes; diverse substrate range Redox enzyme transport

Future Directions and Challenges

  • Structural Resolution: Cryo-EM studies are needed to resolve TatC’s conformational changes during substrate binding .

  • Engineering Applications: Optimizing TatC for synthetic biology to export complex enzymes (e.g., multi-copper oxidases) .

  • Therapeutic Potential: Targeting TatC in antibiotic-resistant pathogens requires deeper mechanistic understanding .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific requirement for the format, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
tatC; Pcar_0094; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1)
Target Names
tatC
Target Protein Sequence
MVDASLIDHLDELRRRLMIAGGAWLLGALICYAFSQQLFQAVSAPLRQALPEGSSLVFIH ATEPFFTYIKLSAMAGLLLSLPVIFWQLWAFVAPGLYPSEKRLALPFVLASSGCFGAGAW FGFGYVFPLVFRFLVSYGTEVGNISAMLSMGAYLSLSCRLLLAFGLVFELPILIFFLTRM GIVDHFWLARRRRTALLLAFVVGAVLTPPDIVSQLAIAGPFVVLYEVSIVVARVGAKRSR DAFSEENSAE
Uniprot No.

Target Background

Function
TatC, a component of the twin-arginine translocation (Tat) system, facilitates the transport of large folded proteins across membranes. These proteins contain a characteristic twin-arginine motif within their signal peptide. Together with TatB, TatC forms a receptor directly interacting with Tat signal peptides.
Database Links
Protein Families
TatC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pelobacter carbinolicus and why is it significant in microbiological research?

Pelobacter carbinolicus is a gram-negative, non-spore forming bacterial species belonging to the Geobacteraceae family. It is strictly anaerobic and commonly used in microbial experimentation . The organism's significance derives from its unique metabolic capabilities, particularly its ability to ferment substrates such as ethanolamine, ethanol, and propanediol into acetate and H₂ or formate when grown syntrophically with partner organisms .

The bacterium's genome has been fully sequenced, allowing for detailed genetic studies . P. carbinolicus serves as an important model organism for studying:

  • Anaerobic metabolism mechanisms

  • Interspecies electron transfer processes

  • Syntrophic relationships in microbial communities

  • Energy conservation in substrate-limited environments

Research methodologies for culturing P. carbinolicus require strict anaerobic conditions, specialized media formulations, and often co-culture techniques with methanogenic partners such as Methanospirillum hungatei .

What is the Twin-Arginine Translocation (Tat) system and what role does TatC play?

The Twin-Arginine Translocation (Tat) system is a specialized protein transport mechanism that allows fully folded proteins to cross biological membranes . Unlike the more common Sec pathway that transports unfolded proteins, the Tat system can translocate proteins that have already acquired their tertiary structure, often including proteins with bound cofactors.

TatC functions as a core component of this system, working alongside TatA and TatB proteins . Research methods to study TatC function typically include:

  • Genetic approaches:

    • Creation of conditional tatC mutants (direct knockouts may be lethal)

    • Complementation studies with controlled expression systems

    • Site-directed mutagenesis of conserved residues

  • Biochemical assays:

    • Activity measurements of Tat-dependent enzymes like hydrogenase

    • Subcellular fractionation to assess protein localization

    • Protein-protein interaction studies using crosslinking techniques

TatC is particularly important as it serves as the initial recognition component for the twin-arginine signal peptides found in Tat-dependent proteins . Experimental evidence indicates that TatC mutations can significantly reduce activities of Tat-dependent enzymes and impair cellular functions .

What methodological approaches are optimal for expressing and purifying recombinant P. carbinolicus TatC?

Expressing and purifying membrane proteins like TatC presents significant challenges due to their hydrophobic nature and complex folding requirements. Based on current research methodologies, the following approach is recommended:

Expression System Selection:

  • E. coli-based systems:

    • BL21(DE3) with pET vectors for initial trials

    • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Consider fusion tags (MBP, SUMO) to enhance solubility

  • Expression Optimization Parameters:

ParameterStandard ConditionOptimization RangeNotes
Temperature37°C16-25°CLower temperatures reduce inclusion body formation
Inducer concentration1.0 mM IPTG0.1-0.5 mM IPTGGradual induction preserves membrane integrity
MediaLBTB, 2xYT, auto-inductionRich media support membrane protein synthesis
Growth phaseMid-logEarly to late logTiming affects membrane protein yields
AerationHighModerateExcessive aeration can damage membrane proteins
  • Extraction and Purification Protocol:

    • Membrane isolation through ultracentrifugation

    • Solubilization using mild detergents (DDM, LDAO)

    • Purification using immobilized metal affinity chromatography with His-tagged constructs

    • Size exclusion chromatography to assess protein aggregation state

  • Quality Control Assessments:

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to evaluate aggregation state

    • Functional assays for activity verification

This methodical approach addresses the specific challenges of membrane protein expression while maximizing the likelihood of obtaining functionally active recombinant TatC protein.

How can researchers effectively design genetic manipulation systems for P. carbinolicus to study TatC function?

Conjugation Protocol Optimization:

  • Vector selection considerations:

    • Broad-host-range plasmids with appropriate origins of replication

    • Anaerobe-compatible selection markers

    • Promoters functional in P. carbinolicus

  • Conjugation procedure:

    • Use E. coli donor strains with helper plasmids containing conjugation machinery

    • Conduct mating on solid media under strict anaerobic conditions

    • Extend incubation time to 24-48 hours for conjugation

    • Implement selection using appropriate antibiotics

  • Verification methods:

    • PCR screening for plasmid integration (most successful approach to date)

    • Sequencing confirmation of genetic modifications

    • Phenotypic testing for expected metabolic changes

Alternative Approaches to Consider:

MethodKey ParametersAdvantagesLimitations
ElectroporationField strength: 8-12 kV/cm
Cell density: early log phase
DNA concentration: 0.5-2 μg
Direct transformation
No biological barriers
Cell wall sensitivity
Low efficiency with anaerobes
Natural transformationDNA exposure during competent state
Optimized media conditions
Simplicity
Less cell damage
Species-specific competence
Lower efficiency
Conditional expressionInducible promoter systems
Antisense RNA strategies
Studies essential genes
Titratable expression
Requires baseline genetic tools
Leaky expression challenges

The most promising methodology based on current research involves conjugation, as PCR screening has indicated successful incorporation of plasmids into the P. carbinolicus genome . Continued refinement of these protocols and adaptation of techniques from related species offer the best path forward for genetic manipulation of this organism.

What experimental approaches can determine which P. carbinolicus proteins depend on the TatC system for translocation?

Identifying the complete set of Tat-dependent proteins in P. carbinolicus requires a multi-faceted experimental approach:

Computational Prediction Methods:

  • Genome scanning for twin-arginine signal peptides with the consensus motif (S/T-R-R-x-F-L-K)

  • Machine learning algorithms trained on known bacterial Tat substrates

  • Comparative analysis with Tat substrates identified in related bacteria

Experimental Verification Techniques:

  • Conditional TatC depletion system development:

    • Creation of an IPTG-inducible tatC expression system (similar to approaches in H. pylori)

    • Monitoring protein localization changes under depletion conditions

  • Proteomic approaches:

    • Comparative analysis of periplasmic fractions between wild-type and TatC-depleted conditions

    • SILAC or TMT labeling for quantitative comparison

    • Mass spectrometry identification of mislocalized proteins

  • Enzyme activity assays:

    • Measuring activities of predicted Tat-dependent enzymes

    • Focusing on enzymes like hydrogenase and formate dehydrogenase that are common Tat substrates in related species

Based on research in related bacteria, likely Tat substrates in P. carbinolicus would include:

Protein CategoryExamplesDetection MethodRationale
HydrogenasesHydAHydrogen evolution assayKnown Tat substrate in many bacteria
Formate dehydrogenasesFdhFormate oxidation assayContains complex cofactors requiring cytoplasmic insertion
Iron-sulfur proteinsVarious oxidoreductasesActivity assays, protein localizationComplex cofactor assembly preceding export
Catalase-associated proteinsKapA homologsCatalase activity assayIdentified as Tat-dependent in H. pylori

This systematic approach combines predictive algorithms with experimental validation to comprehensively identify the Tat-dependent proteome in P. carbinolicus.

How do researchers address the challenges of studying syntrophic relationships involving P. carbinolicus and the role of TatC?

P. carbinolicus engages in syntrophic relationships with methanogenic partners, presenting unique research challenges . Studying the role of TatC in these relationships requires specialized methodological approaches:

Co-culture Experimental Systems:

  • Establishment of defined syntrophic partnerships (e.g., with Methanospirillum hungatei)

  • Development of specialized anaerobic cultivation techniques that maintain both partners

  • Implementation of monitoring systems for interspecies metabolite exchange

Methodological Solutions for Specific Challenges:

ChallengeMethodological SolutionImplementation Details
Maintaining strict anaerobiosisAdvanced anaerobic cultivationUse of anaerobic chambers with controlled atmosphere (N₂:CO₂:H₂)
Pre-reduced media with appropriate reducing agents
Oxygen indicators (resazurin) in media
Monitoring interspecies electron transferSpecialized analytical techniquesHydrogen partial pressure measurement (maximum ~1,000 Pa in co-cultures)
Formate concentration determination (~2 mM in co-cultures)
Calculation of redox potentials (E'H₂ ≈ -358 mV, E'HCOOH ≈ -366 mV)
Differentiating partner contributionsPartner-specific measurementsSpecies-specific gene expression analysis
Metabolic labeling with stable isotopes
Selective inhibition approaches
Determining energy conservationBioenergetic analysesCalculation of available Gibbs free energy (-35 to -28 kJ/mol ethanol)
ATP yield determination
Growth yield measurements

Research has shown that P. carbinolicus exploits a narrow energetic niche in syntrophic partnerships, with maximum Gibbs free energy ranging from -35 to -28 kJ per mol ethanol . Understanding how the Tat system contributes to this specialized metabolism requires integrating data from multiple experimental approaches.

What strategies address the challenges of working with the oxygen-sensitive proteins of P. carbinolicus, particularly in Tat system studies?

The strict anaerobic nature of P. carbinolicus presents significant challenges when studying oxygen-sensitive proteins, including those related to the Tat system. Effective methodological strategies include:

Protein Purification Under Anaerobic Conditions:

  • Use of anaerobic chambers or glove boxes for all purification steps

  • Inclusion of oxygen scavengers in buffers (e.g., dithionite, dithiothreitol)

  • Gas-tight syringe systems for sample transfer

  • Rapid work flow to minimize exposure time

Specialized Analytical Techniques:

  • Activity assays under anaerobic conditions:

    • Gas-tight cuvettes for spectrophotometric measurements

    • Oxygen-free buffer systems

    • Quick-coupling anaerobic transfer systems

  • Structural preservation approaches:

    • Stabilizing agents specific to the protein class

    • Cryo-preparation techniques to trap native states

    • Rapid freezing methods to preserve structure

Storage and Handling Protocols:

Protein TypeStorage ConditionsStability EnhancementAnalytical Considerations
Hydrogenases-80°C under argon atmosphereAddition of glycerol (10-20%)
Inclusion of reducing agents
Reactivation protocols before assays
Account for partial activity loss
OxidoreductasesLiquid nitrogen
Anaerobic at -20°C
Oxygen-scavenging enzyme systems
Protective protein additives
Standard curve with fresh preparations
Activity normalization methods
Membrane proteins (TatC)Detergent micelles with stabilizers
Proteoliposomes
Cholesterol or lipid additives
Amphipol stabilization
Detergent background in assays
Native membrane mimicking systems

These methodological approaches address the specific challenges of working with oxygen-sensitive proteins from strictly anaerobic organisms like P. carbinolicus, enabling more reliable and reproducible studies of the Tat system and its substrates.

How does understanding P. carbinolicus TatC contribute to broader knowledge about bacterial protein translocation systems?

Research on P. carbinolicus TatC can be integrated with broader bacterial protein translocation studies through comparative methodological approaches:

Evolutionary Perspective Analysis:

  • Multiple sequence alignment of TatC proteins across diverse bacteria

  • Phylogenetic analysis to trace evolutionary relationships

  • Identification of conserved vs. variable regions specific to anaerobic species

Comparative Functional Studies:

  • Heterologous expression of P. carbinolicus TatC in model organisms

  • Complementation experiments with TatC from aerobic vs. anaerobic bacteria

  • Chimeric protein construction to identify domain-specific functions

Methodological Integration Table:

Research AreaP. carbinolicus TatC ContributionMethodological ApproachBroader Impact
Protein folding quality controlRole in anaerobic environmentsCompare misfolded protein handling between aerobic/anaerobic systemsExpands understanding of protein homeostasis mechanisms
Energy conservation in transportProton motive force utilizationMeasure energy requirements in various electron acceptor conditionsClarifies bioenergetic constraints across bacterial diversity
Cofactor insertion mechanismsHandling of oxygen-sensitive cofactorsTrack cofactor incorporation in reconstituted systemsInforms synthetic biology applications for complex enzyme production
Signal peptide recognitionTwin-arginine motif specificitySignal sequence swapping experiments between diverse speciesEnhances predictive algorithms for substrate identification

This integration of P. carbinolicus TatC research with broader bacterial translocation studies provides valuable comparative insights and expands our understanding of how protein transport systems have adapted to diverse ecological niches.

What experimental design approaches best address the mechanistic questions about TatC function in P. carbinolicus?

Addressing mechanistic questions about TatC function in P. carbinolicus requires robust experimental design approaches that account for the organism's unique characteristics:

Mechanistic Question Framework:

  • Substrate recognition mechanisms:

    • Site-directed mutagenesis of twin-arginine binding pocket residues

    • Synthetic peptide binding assays with purified TatC

    • Computational docking of signal peptides to predicted binding sites

  • Translocation channel formation:

    • Crosslinking studies to capture transient TatA-TatC interactions

    • Electrophysiological measurements of reconstituted systems

    • Single-molecule tracking of fluorescently labeled components

Experimental Design Best Practices:

Design ElementImplementation StrategyMethodological Considerations
Control selectionInclude positive controls (known Tat substrates)
Negative controls (Sec-dependent proteins)
System controls (heterologous Tat systems)
Ensure controls match experimental conditions
Validate control behaviors independently
Include technical and biological replicates
Variable isolationFactorial experimental designs
Single-variable manipulation
Gradient approaches for continuous variables
Account for interaction effects
Establish appropriate variable ranges
Determine minimum detectable effect size
Statistical analysisPower analysis for sample size determination
Appropriate statistical tests (t-tests, ANOVA)
Multiple testing correction
Account for non-normal distributions
Consider nested experimental structures
Report effect sizes alongside p-values
Validation strategiesOrthogonal methodology validation
Independent experimental replication
Reverse complementation approaches
Verify with biochemical and genetic approaches
Test in multiple strain backgrounds
Confirm with in vivo and in vitro systems

Following principles of robust experimental design ensures that mechanistic questions about TatC function in P. carbinolicus can be addressed with appropriate rigor and reproducibility, advancing our understanding of this important protein translocation system.

What emerging methodologies could advance our understanding of TatC function in P. carbinolicus?

Several emerging methodologies show promise for deepening our understanding of TatC function in P. carbinolicus:

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy for membrane protein complexes

  • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

  • Solid-state NMR techniques optimized for membrane proteins

  • Time-resolved X-ray crystallography for capturing transient states

Systems Biology Integration:

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

  • Genome-scale metabolic modeling incorporating protein translocation constraints

  • Network analysis of protein-protein interactions centered on TatC

  • Machine learning for predicting Tat substrates based on multiple sequence features

Emerging Technologies with High Potential:

TechnologyApplication to TatC ResearchMethodological Advantages
CRISPR interferenceTunable repression of tatC expressionPrecise control of expression levels
Minimal off-target effects
Compatible with essential genes
Nanopore recordingDirect measurement of protein translocationSingle-molecule resolution
Real-time kinetic data
Minimal sample preparation
Proximity labelingIn vivo mapping of TatC interaction partnersCaptures transient interactions
Works in native membrane environment
Identifies spatial relationships
In-cell NMRStructural studies in cellular contextMaintains native conditions
Reveals dynamic changes
Avoids purification artifacts

These emerging methodologies, when adapted for the specific challenges of working with P. carbinolicus, could significantly advance our understanding of TatC function and the broader Tat system in this organism.

How can understanding P. carbinolicus TatC function inform biotechnological applications?

Knowledge about P. carbinolicus TatC function has potential applications in several biotechnological areas:

Bioenergy Applications:

  • Engineering syntrophic relationships for enhanced biogas production

  • Optimizing electron transfer mechanisms for microbial fuel cells

  • Developing anaerobic biocatalysts for waste-to-energy conversion

  • Improving hydrogen production through hydrogenase optimization

Protein Engineering Platforms:

  • Designing export systems for oxygen-sensitive enzymes

  • Creating anaerobic expression systems for complex proteins

  • Developing folded protein secretion systems for industrial enzymes

  • Engineering signal peptides for targeted protein localization

Methodological Framework for Application Development:

Application AreaP. carbinolicus TatC ContributionResearch ApproachPotential Impact
Anaerobic biocatalysisExport of fully folded, cofactor-containing enzymesEngineer chimeric Tat systems for industrial hosts
Optimize signal peptides for industrial enzymes
Enhanced production of oxygen-sensitive biocatalysts
Cost reduction in enzyme manufacturing
Metabolic engineeringPathway optimization for electron transferIntegrate Tat components in syntrophic consortia
Enhance interspecies electron transfer
Improved biofuel yields
More efficient waste treatment processes
BiosensingDevelopment of redox-sensitive detection systemsEngineer bacterial sensors with Tat-exported reporters
Create anaerobic biosensors for environmental monitoring
Detection systems for oxygen-limited environments
Industrial process monitoring tools
Synthetic biologyNovel cellular compartmentalizationDesign artificial protein targeting systems
Create synthetic electron transfer chains
New cellular architectures
Enhanced metabolic channeling

By understanding the fundamental mechanisms of P. carbinolicus TatC function, researchers can develop innovative biotechnological applications that leverage the unique capabilities of the Tat system for protein transport and syntrophic metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.