Recombinant Pelobacter carbinolicus UPF0059 membrane protein Pcar_2070 (Pcar_2070)

Shipped with Ice Packs
In Stock

Description

Introduction to Pelobacter carbinolicus UPF0059 Membrane Protein

Pcar_2070 is classified as a UPF0059 family membrane protein encoded in the genome of Pelobacter carbinolicus strain DSM 2380 / Gra Bd 1 . As a membrane protein, it plays a potentially important role in cellular processes at the bacterial membrane interface. The protein is identified in genomic analyses of P. carbinolicus, an anaerobic bacterium belonging to the Geobacteraceae family, known for its unique metabolic capabilities including iron reduction and fermentation of specific substrates .

The UPF0059 designation indicates this protein belongs to a family of uncharacterized proteins with predicted function, suggesting that while its sequence has been determined, detailed functional characterization remains incomplete. This membrane protein is one of several proteins identified in the comprehensive genomic analysis of P. carbinolicus, which revealed various membrane-associated proteins potentially involved in electron transfer and membrane transport functions .

Biochemical Properties

The biochemical properties of Pcar_2070 are summarized in the following table:

PropertyCharacteristic
UniProt AccessionQ3A2U7
OrganismPelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)
Protein FamilyUPF0059 membrane protein family
Length188 amino acids
Molecular WeightApproximately 19-20 kDa (estimated)
Cellular LocationMembrane-embedded
Gene LocusPcar_2070

The protein's hydrophobic profile and structural predictions suggest it contains multiple membrane-spanning regions, consistent with its classification as an integral membrane protein .

Genetic Characterization

Pcar_2070 is encoded within the Pelobacter carbinolicus genome, which has been fully sequenced . The gene is identified by the ordered locus name Pcar_2070, indicating its position within the genomic sequence. The completion of the P. carbinolicus genome sequence has revealed numerous genes encoding membrane proteins, including Pcar_2070, that were previously unrecognized in this organism .

Expression Patterns

Transcriptomic analysis of P. carbinolicus has detected expression of multiple genes encoding membrane proteins under various growth conditions . While specific expression data for Pcar_2070 is limited in the available search results, it is noted that P. carbinolicus expresses most of its membrane protein genes under one or more growth conditions . This suggests that Pcar_2070 may be expressed under specific physiological conditions relevant to the bacterium's metabolism or environmental adaptation.

Membrane Protein Research Context

Membrane proteins play crucial roles in numerous biological processes and are important drug targets . The study of membrane proteins presents significant challenges due to their hydrophobic nature and the difficulty of maintaining their native conformations outside the lipid bilayer environment . Recent advances in structural biology techniques, including vesicle-based technologies, have enabled more accurate studies of membrane proteins in their native states .

Relationship to Bacterial Physiology

P. carbinolicus is particularly noteworthy for its metabolic versatility, including its ability to reduce Fe(III) and ferment specific substrates . Analysis of the P. carbinolicus genome has revealed genes encoding c-type cytochromes and other membrane proteins that may be involved in electron transfer processes . While the specific role of Pcar_2070 has not been definitively established, its presence as a membrane protein suggests potential involvement in membrane-associated processes such as transport, signaling, or energy transduction.

Research Applications

The availability of recombinant Pcar_2070 enables various research applications, including:

  1. Structural studies using techniques such as X-ray crystallography, NMR, or cryo-electron microscopy

  2. Functional characterization through biochemical assays

  3. Generation of antibodies for localization studies

  4. Investigation of protein-protein or protein-ligand interactions

  5. Comparative studies with related membrane proteins from other bacterial species

Challenges in Membrane Protein Research

Structural studies of membrane proteins present unique challenges due to their hydrophobic nature and tendency to denature when removed from the lipid bilayer . Traditional methods for membrane protein analysis often rely on detergent solubilization, which may not accurately reflect the protein's native state .

Innovative Approaches for Membrane Protein Analysis

Recent advances in membrane protein research include vesicle-based technologies that enable the study of membrane proteins in their native lipid environments, bypassing the limitations of detergent solubilization . Such approaches could potentially be applied to Pcar_2070 to better understand its structure-function relationships in the context of the bacterial membrane.

Comparative Analysis

P. carbinolicus belongs to the Geobacteraceae family, which includes other genera such as Geobacter and Desulfuromonas . While P. carbinolicus was previously thought to lack c-type cytochromes common in related species, genomic analysis has revealed genes for several membrane proteins, including Pcar_2070 . This suggests potential evolutionary relationships and functional parallels with membrane proteins in related species.

Functional Characterization

Future research should focus on determining the specific function of Pcar_2070, potentially through gene knockout studies, expression analysis under various conditions, or biochemical characterization of the purified protein. Investigation of potential binding partners or substrates would provide valuable insights into the protein's role in cellular processes.

Comparative Genomics

Comparative analysis of UPF0059 family proteins across different bacterial species could reveal evolutionary conservation patterns and functional significance. Such analyses might identify conserved motifs or domains with specific functional implications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; Pcar_2070; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1)
Target Names
mntP
Target Protein Sequence
MDMITLFGLALALAMDAFAVALGCGLTLERLTGRHLFRLGWHFGLFQAMMPIIGWLAGLT VQKWIETYDHWVAFGLLVCVGGKMIHEAFQDEETRESRDDPTRGMSLIMLSVATSIDALA VGLSLAIVGISVWFPALIIGIIAGVMTVIGMLLGRRAGARWGQRVEIAGGLILIGIGLKI LWEHTLGM
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the Pcar_2070 gene in Pelobacter carbinolicus?

The Pcar_2070 gene encoding the UPF0059 membrane protein is part of the P. carbinolicus DSM2380 genome, which has been completely sequenced and is available through public databases such as JGI (Joint Genome Institute). This gene belongs to an uncharacterized protein family (UPF0059) and is predicted to encode a membrane-associated protein. While specific data on Pcar_2070's genomic neighborhood is limited in the provided sources, researchers should examine its position relative to other functional genes to gain insights into potential operonic structures or regulatory elements. The genome sequence analysis of P. carbinolicus has revealed multiple membrane-associated proteins, with 14 open reading frames identified as encoding potential c-type cytochromes, some of which are membrane-bound .

How can researchers verify the expression of Pcar_2070 in native P. carbinolicus?

To verify the expression of Pcar_2070 in native P. carbinolicus, researchers can employ RT-PCR (Reverse Transcription Polymerase Chain Reaction) techniques similar to those used for other P. carbinolicus genes. As demonstrated in the study of c-type cytochrome genes, RT-PCR can effectively detect gene expression under different growth conditions such as acetoin fermentation and Fe(III) reduction . For Pcar_2070 specifically, researchers should:

  • Design specific primers targeting the Pcar_2070 gene sequence

  • Extract total RNA from P. carbinolicus grown under various conditions

  • Perform RT-PCR to generate cDNA

  • Amplify the target sequence using the designed primers

  • Analyze products via gel electrophoresis to confirm expression

Additionally, protein expression can be verified using SDS-PAGE combined with immunoblotting using antibodies specific to the UPF0059 protein, similar to the heme-staining approach used for detecting cytochrome proteins in P. carbinolicus .

What are the predicted structural features of the UPF0059 membrane protein Pcar_2070?

The UPF0059 membrane protein Pcar_2070 is classified as a membrane protein, suggesting it contains hydrophobic domains that anchor it within the cell membrane. While the provided sources don't offer specific structural information about Pcar_2070, researchers can utilize several bioinformatic approaches to predict its structural features:

  • Transmembrane domain prediction using tools like TMHMM, TMpred, or HMMTOP

  • Secondary structure prediction using tools such as PSIPRED or JPred

  • Domain identification through Pfam, SMART, or InterPro databases

  • Homology modeling if structural data exists for similar UPF0059 family proteins

For membrane proteins in P. carbinolicus, researchers have successfully categorized them based on cellular localization (cytoplasmic membrane-associated, periplasmic, or outer membrane-associated), which provides a framework for characterizing Pcar_2070 . The UPF0059 designation indicates this is an uncharacterized protein family, suggesting limited existing structural knowledge.

What are the optimal conditions for expressing recombinant Pcar_2070 in heterologous systems?

Optimizing expression of recombinant Pcar_2070 requires careful consideration of several factors:

  • Expression System Selection: While the commercial recombinant Pcar_2070 is produced in yeast , researchers may consider several expression systems:

    • E. coli-based systems (BL21, Rosetta, etc.) for high yield

    • Yeast systems (P. pastoris, S. cerevisiae) for proper folding of eukaryotic-like proteins

    • Insect cell systems for complex membrane proteins requiring extensive post-translational modifications

  • Expression Conditions: For membrane proteins like Pcar_2070, consider:

    • Lower induction temperatures (16-25°C) to slow expression and facilitate proper folding

    • Reduced inducer concentrations to prevent formation of inclusion bodies

    • Addition of membrane-mimicking environments during expression

  • Solubilization Strategies: Since Pcar_2070 is a membrane protein, proper detergent selection is crucial:

    • Screen multiple detergents (DDM, LDAO, Triton X-100, etc.)

    • Consider using amphipols or nanodiscs for stabilization

    • Implement two-step solubilization protocols for improved yield

When evaluating expression success, researchers should analyze both total protein and the membrane fraction specifically, using techniques similar to those employed for characterizing native P. carbinolicus membrane proteins .

What purification strategies are most effective for Pcar_2070 while maintaining protein functionality?

Purifying membrane proteins like Pcar_2070 presents significant challenges that require specialized approaches:

  • Initial Extraction and Solubilization:

    • Cell lysis via sonication or French press under anaerobic conditions (considering P. carbinolicus's anaerobic nature)

    • Membrane fraction isolation by ultracentrifugation

    • Careful detergent solubilization with screening for optimal detergent:protein ratios

  • Chromatography Strategy:

    • Immobilized Metal Affinity Chromatography (IMAC) using His-tagged constructs

    • Size Exclusion Chromatography (SEC) to remove aggregates and ensure monodispersity

    • Ion Exchange Chromatography as a polishing step

  • Quality Assessment:

    • SDS-PAGE with Coomassie and western blotting

    • Circular Dichroism to confirm secondary structure integrity

    • Dynamic Light Scattering to evaluate homogeneity

For membrane proteins from P. carbinolicus, researchers have successfully employed SDS-PAGE followed by specific staining methods to identify and characterize proteins of interest . When working with recombinant versions, similar approaches combined with tag-specific detection methods would be appropriate.

How can researchers assess the functionality of purified recombinant Pcar_2070?

Assessing functionality of the purified Pcar_2070 protein requires multiple approaches since its precise function remains uncharacterized:

  • Structural Integrity Verification:

    • Circular Dichroism (CD) spectroscopy to confirm secondary structure

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to verify proper folding

  • Membrane Association Studies:

    • Liposome reconstitution assays

    • Nanodiscs incorporation

    • Fluorescence-based membrane insertion assays

  • Potential Functional Assays:

    • Protein-protein interaction studies using pull-down assays

    • Electron transfer capability assessment if involved in redox processes

    • Binding assays with potential substrates identified through bioinformatic prediction

Since P. carbinolicus exhibits both fermentative metabolism and Fe(III) reduction capabilities, researchers might test if Pcar_2070 participates in either pathway by examining its expression under different growth conditions using methods similar to those employed for other membrane proteins in this organism .

How does Pcar_2070 compare with homologous proteins in other members of the Geobacteraceae family?

Comparative analysis of Pcar_2070 with homologous proteins in related organisms can provide valuable insights into its evolutionary conservation and potential function:

  • Sequence Alignment Analysis:

    • Perform BLAST searches against genomes of Geobacter sulfurreducens, Geobacter metallireducens, and Desulfuromonas species

    • Construct multiple sequence alignments to identify conserved residues

    • Calculate sequence identity and similarity percentages

  • Phylogenetic Analysis:

    • Generate phylogenetic trees to visualize evolutionary relationships

    • Compare gene neighborhoods to identify synteny or rearrangements

    • Assess selection pressure through Ka/Ks ratio analysis

  • Structural Comparison:

    • Identify structurally characterized homologs

    • Create homology models for comparison

    • Analyze conservation patterns in potential functional sites

The genome analysis of P. carbinolicus has revealed both shared and distinct features compared to other Geobacteraceae members. For instance, while P. carbinolicus contains cytochrome c genes, the number is significantly lower than in G. sulfurreducens, and many cytochromes required for optimal Fe(III) reduction in G. sulfurreducens are absent in P. carbinolicus . Similar comparative approaches would be valuable for understanding Pcar_2070's relationship to homologs.

SpeciesNumber of Predicted c-type CytochromesPcar_2070 Homolog PresentSequence Identity to Pcar_2070
P. carbinolicus14Yes (reference)100%
G. sulfurreducens>100Variable (requires analysis)Requires analysis
G. metallireducens>80Variable (requires analysis)Requires analysis
D. acetoxidansVariableVariable (requires analysis)Requires analysis

What role might Pcar_2070 play in P. carbinolicus electron transfer processes during Fe(III) reduction?

Investigating Pcar_2070's potential role in electron transfer processes requires systematic approaches:

  • Expression Analysis Under Different Electron Acceptor Conditions:

    • Quantify Pcar_2070 expression during growth with different electron acceptors (Fe(III), fumarate, etc.)

    • Compare expression patterns with known electron transfer proteins

    • Use RT-qPCR or RNA-Seq for comprehensive transcriptomic analysis

  • Localization and Interaction Studies:

    • Determine precise subcellular localization using fractionation techniques

    • Identify interaction partners through co-immunoprecipitation

    • Perform crosslinking studies to capture transient interactions

  • Functional Characterization:

    • Develop knockout or knockdown strategies if genetic systems are available

    • Measure electron transfer rates in reconstituted systems

    • Perform electrochemical analyses to determine redox properties

Research on c-type cytochromes in P. carbinolicus has identified proteins specifically expressed during Fe(III) reduction but not during fermentation, suggesting specialized roles in electron transfer to Fe(III) . Similar differential expression analysis for Pcar_2070 would provide clues about its potential involvement in these processes.

How can structural biology approaches be applied to elucidate the function of Pcar_2070?

Structural biology offers powerful tools for understanding the function of uncharacterized proteins like Pcar_2070:

  • X-ray Crystallography Approach:

    • Optimize protein construct design through limited proteolysis

    • Screen crystallization conditions specifically designed for membrane proteins

    • Consider lipidic cubic phase crystallization

    • Analyze crystal structures to identify potential binding sites or functional motifs

  • Cryo-Electron Microscopy Strategy:

    • Prepare samples in detergent micelles, amphipols, or nanodiscs

    • Collect high-resolution image data using direct electron detectors

    • Process data using single-particle analysis workflows

    • Generate 3D reconstructions to visualize protein architecture

  • NMR Spectroscopy Applications:

    • Produce isotopically labeled protein (15N, 13C)

    • Perform solution NMR for soluble domains

    • Consider solid-state NMR for membrane-embedded regions

    • Analyze chemical shift perturbations upon ligand addition to identify binding sites

  • Integrative Structural Biology:

    • Combine multiple structural techniques with computational modeling

    • Validate models through mutagenesis of predicted functional sites

    • Correlate structural features with biochemical assays

The limited structural information available for proteins from P. carbinolicus suggests that structural studies of Pcar_2070 would make significant contributions to understanding this organism's biology .

What are the optimal storage conditions for maintaining the stability of recombinant Pcar_2070?

Maintaining stability of recombinant membrane proteins like Pcar_2070 requires careful attention to storage conditions:

  • Buffer Optimization:

    • Screen buffers with varying pH (typically 7.0-8.0 for most membrane proteins)

    • Test different ionic strengths (150-300 mM NaCl common for membrane proteins)

    • Include stabilizing agents like glycerol (10-20%)

    • Add reducing agents (DTT or TCEP) if cysteine residues are present

  • Storage Temperature Considerations:

    • Short-term: 4°C with appropriate detergent concentration

    • Medium-term: -20°C with cryoprotectants

    • Long-term: -80°C in small aliquots to avoid freeze-thaw cycles

  • Detergent Concentration Management:

    • Maintain detergent above critical micelle concentration (CMC)

    • Consider detergent exchange to more stable alternatives for long-term storage

    • Monitor detergent degradation over time

  • Alternative Stabilization Approaches:

    • Reconstitution into liposomes or nanodiscs for enhanced stability

    • Lyophilization with appropriate excipients

    • Addition of specific lipids that may enhance protein stability

Commercial recombinant proteins like Pcar_2070 typically ship without dry ice , suggesting certain inherent stability, but researchers should determine optimal conditions specific to their experimental needs.

What techniques are most effective for studying protein-protein interactions involving Pcar_2070?

Investigating protein-protein interactions for membrane proteins presents unique challenges requiring specialized techniques:

  • In Vitro Binding Assays:

    • Pull-down assays using affinity-tagged Pcar_2070

    • Surface Plasmon Resonance (SPR) with careful detergent management

    • Microscale Thermophoresis for quantitative binding measurements

    • Isothermal Titration Calorimetry for thermodynamic parameters

  • Cross-linking Approaches:

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • Photo-activatable amino acid incorporation at specific positions

    • In vivo cross-linking to capture physiologically relevant interactions

  • Advanced Microscopy Methods:

    • Förster Resonance Energy Transfer (FRET) using labeled proteins

    • Fluorescence Correlation Spectroscopy for dynamic interactions

    • Single-molecule tracking in reconstituted systems

  • Proteomics-Based Methods:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling using BioID or APEX2 fusion proteins

    • Membrane-specific interactome mapping

Researchers studying P. carbinolicus proteins have successfully employed protein identification techniques like mass spectrometry to characterize protein complexes , which could be adapted for studying Pcar_2070 interactions.

How can researchers develop specific antibodies against Pcar_2070 for immunological studies?

Developing specific antibodies against membrane proteins like Pcar_2070 requires strategic approaches:

  • Antigen Design Strategies:

    • Full-length protein approach: Use purified recombinant Pcar_2070 in detergent micelles

    • Peptide approach: Identify antigenic epitopes from hydrophilic regions

    • Domain approach: Express and purify soluble domains separately

  • Antibody Production Options:

    • Polyclonal antibodies: Immunize rabbits or other animals with purified protein

    • Monoclonal antibodies: Screen hybridoma clones for specificity

    • Recombinant antibodies: Phage display selection against the target

  • Validation Methods:

    • Western blotting against recombinant protein and native extracts

    • Immunoprecipitation efficiency testing

    • Immunofluorescence localization pattern analysis

    • Preabsorption controls to confirm specificity

  • Optimization for Membrane Protein Applications:

    • Test antibodies under native and denaturing conditions

    • Evaluate detergent compatibility for immunoprecipitation

    • Optimize fixation methods for immunohistochemistry

Researchers can use the purified recombinant Pcar_2070 protein available commercially as a positive control during antibody validation and for affinity purification of the generated antibodies.

What opportunities exist for using CRISPR-Cas9 genome editing to study Pcar_2070 function in P. carbinolicus?

Developing genetic tools for studying Pcar_2070 through genome editing presents both challenges and opportunities:

  • Adaptation of CRISPR-Cas9 for P. carbinolicus:

    • Optimize codon usage of Cas9 for expression in P. carbinolicus

    • Develop appropriate promoters for guide RNA expression

    • Establish efficient transformation protocols for this anaerobic bacterium

    • Design homology-directed repair templates for precise modifications

  • Target Modifications for Functional Analysis:

    • Gene deletion to assess essentiality and phenotypic consequences

    • Point mutations in predicted functional residues

    • Epitope tagging for localization and interaction studies

    • Promoter replacements for controlled expression

  • Screening and Validation Strategies:

    • Design selective screening methods for successful editing events

    • Develop phenotypic assays related to Fe(III) reduction or membrane function

    • Implement whole-cell electron transfer measurements

    • Apply omics approaches to assess system-wide effects

It's worth noting that genetic manipulation in P. carbinolicus has been challenging, as noted in the literature: "definitive elucidation of the functions of the genes in P. carbinolicus with genetic approaches has not been possible yet because techniques for generating specific mutations via homologous recombination that have been successful in G. sulfurreducens have not worked well in P. carbinolicus" . This highlights the need for developing customized genetic tools for this organism.

How might systems biology approaches integrate Pcar_2070 into P. carbinolicus metabolic networks?

Systems biology offers powerful frameworks for understanding Pcar_2070's role within the broader context of P. carbinolicus metabolism:

  • Multi-omics Integration:

    • Transcriptomics: RNA-Seq under various growth conditions

    • Proteomics: Quantitative analysis of protein expression patterns

    • Metabolomics: Identification of altered metabolic profiles

    • Fluxomics: Measurement of metabolic flux distributions

  • Network Analysis Approaches:

    • Protein-protein interaction network mapping

    • Regulatory network reconstruction

    • Metabolic pathway modeling

    • Flux balance analysis incorporating membrane protein functions

  • Computational Modeling:

    • Genome-scale metabolic modeling including membrane transport functions

    • Kinetic modeling of potential enzymatic activities

    • Machine learning approaches to predict protein function from multi-omics data

  • Experimental Validation:

    • Targeted metabolite analysis in wild-type vs. modified strains

    • 13C metabolic flux analysis to track carbon flow

    • In vitro reconstitution of predicted pathways

P. carbinolicus exhibits multiple metabolic capabilities, including acetoin fermentation and Fe(III) reduction , providing diverse contexts for understanding Pcar_2070's potential roles through systems approaches.

What insights could comparative metagenomics provide about the distribution and evolution of Pcar_2070 homologs in environmental samples?

Exploring the environmental distribution and evolution of Pcar_2070 homologs through metagenomics offers valuable ecological context:

  • Metagenomic Survey Strategies:

    • Target environments where Geobacteraceae are prevalent (anaerobic sediments, subsurface environments)

    • Design specific primers or probes for Pcar_2070 homologs

    • Apply both amplicon and shotgun metagenomic approaches

    • Develop bioinformatic pipelines for sensitive homolog detection

  • Evolutionary Analysis:

    • Construct phylogenetic trees of environmental homologs

    • Identify selection pressures through dN/dS analysis

    • Detect horizontal gene transfer events

    • Map conservation patterns to functional domains

  • Ecological Correlation Studies:

    • Correlate homolog presence with biogeochemical parameters

    • Assess co-occurrence patterns with other genes

    • Compare abundance across redox gradients

    • Evaluate expression in metatranscriptomic datasets

  • Functional Metagenomics:

    • Clone environmental variants into expression systems

    • Screen for functional differences in heterologous hosts

    • Conduct site-directed mutagenesis based on environmental variation

    • Perform comparative biochemical characterization

The analysis of P. carbinolicus cytochromes revealed differences compared to other Geobacteraceae , suggesting that similar comparative approaches for Pcar_2070 could yield insights into its adaptation to specific ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.