Recombinant Pelobacter propionicus ATP synthase subunit a 1 (atpB1)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

As part of the F0 sector, subunit a 1 interacts with the c-ring rotor to create a proton gradient across the membrane, driving ATP synthesis in the F1 sector . Structural studies of homologous ATP synthases (e.g., Mycobacterium smegmatis) reveal:

  • Proton Translocation: A polar L-shaped tunnel in subunit a facilitates proton movement via Grotthuss water chains .

  • Regulatory Mechanisms: Auto-inhibitory loops in bacterial ATP synthases prevent ATP hydrolysis, ensuring unidirectional ATP synthesis .

Enzymatic Studies

  • Kinetic Analysis: Used to investigate ATP hydrolysis/synthesis rates and proton coupling efficiency .

  • Structural Biology: Serves as a model for cryo-EM studies to resolve rotational substates during catalytic cycles .

Biotechnological Relevance

  • Metabolic Engineering: P. propionicus participates in syntrophic cocultures for propionate production from CO . Recombinant atpB1 could optimize such systems by enhancing ATP synthase efficiency.

  • Drug Development: Subunit a’s role in proton channeling makes it a target for antimicrobial agents against pathogenic bacteria .

Biochemical Stability and Handling

ParameterRecommendation
ReconstitutionUse deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .
Freeze-ThawAvoid repeated cycles; aliquot working volumes stored at 4°C for ≤1 week .

Comparative Insights

  • Archaea vs. Bacteria: Unlike archaeal A-ATP synthases, which require subunit F for ATPase activation , bacterial F-ATP synthases like P. propionicus rely on subunit a’s interaction with the c-ring .

  • Cyanobacterial Analogues: The γ-subunit in cyanobacteria includes a β-hairpin structure absent in P. propionicus, highlighting evolutionary divergences in ATP synthase regulation .

Future Directions

  • Mechanistic Studies: Resolving substates of the P. propionicus ATP synthase rotary cycle could elucidate torque generation and proton coupling .

  • Industrial Optimization: Enhancing ATP synthase efficiency in synthetic microbial consortia may improve carbon fixation and propionate yields .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB1; Ppro_0599; ATP synthase subunit a 1; ATP synthase F0 sector subunit a 1; F-ATPase subunit 6 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Target Names
atpB1
Target Protein Sequence
MVHPLLFLEFFRKLLEPLHMSEAGADAVAYTWLIMLLLLLFSFLATRALKMIPCGLQNFM EVVVGGVENMIVETMGEHGRPYFPLVATVGLFVLVSNLIGLIPGFFPPTANINTTAACAI VVFIATHVVGIKRHGIGYIKHFCGPILWLAPVMFFIEVIGHLSRPLSLTLRLFGNMNGHE LVLIIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLTMIYIQGSLEEAH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of atpB1 within the ATP synthase complex?

AtpB1 (ATP synthase subunit a 1) is a critical membrane-embedded component of the F0 sector of the F1F0-ATP synthase complex in Pelobacter propionicus. This subunit forms part of the stator assembly and contains the essential half-channels involved in proton translocation across the membrane. The subunit facilitates the conversion of the proton motive force into mechanical rotation of the c-ring, which ultimately drives ATP synthesis in the F1 sector.

The amino acid sequence of P. propionicus atpB1 (229 amino acids) contains highly conserved residues that form the proton-conducting pathway . Its transmembrane helices interact with the rotating c-ring to create the pathway for protons to enter from one side of the membrane and exit on the other, thereby generating the rotational force necessary for ATP synthesis.

What expression systems are optimal for recombinant atpB1 production?

The most effective system for recombinant P. propionicus atpB1 expression is E. coli, as evidenced by multiple successful studies and commercial products . The choice of E. coli strain is critical, with BL21(DE3) often preferred for membrane protein expression due to its reduced protease activity and controlled expression capabilities.

For successful expression:

  • Clone the atpB1 gene into an expression vector containing a strong promoter (T7 is commonly used)

  • Include an N-terminal or C-terminal affinity tag (His-tag is most common) for purification

  • Use reduced induction temperatures (16-25°C) to minimize inclusion body formation

  • Consider codon optimization for improved expression in E. coli

  • Include membrane-protein-specific chaperones to improve folding

When expressing membrane proteins like atpB1, slower expression rates often yield better results for proper membrane integration. Therefore, lower IPTG concentrations (0.1-0.5 mM) and extended expression periods (16-24 hours) at reduced temperatures are recommended .

What purification strategies ensure high yield and functional integrity of recombinant atpB1?

Purification of membrane proteins like atpB1 requires specialized approaches to maintain structural integrity:

  • Membrane Extraction: Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to solubilize the membrane fraction containing atpB1.

  • Affinity Chromatography: For His-tagged atpB1, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective. A typical purification protocol includes:

    • Equilibration buffer: 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole, 0.05% DDM

    • Wash buffer: Same as equilibration with 50 mM imidazole

    • Elution buffer: Same as equilibration with 250-300 mM imidazole

  • Size Exclusion Chromatography: A secondary purification step to remove aggregates and ensure homogeneity:

    • Buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.03% DDM

The purified protein should be stored in a stabilizing buffer containing 50% glycerol at -20°C or -80°C to maintain long-term stability . Avoid repeated freeze-thaw cycles as noted in product specifications.

How can the functional activity of purified atpB1 be assessed?

While isolated atpB1 subunit cannot catalyze ATP synthesis alone, its functional integration into the ATP synthase complex can be assessed through:

  • Reconstitution into Liposomes: Incorporate purified atpB1 with other ATP synthase subunits into liposomes to form a functional complex. This approach was successfully used with other bacterial ATP synthases such as the one from E. callanderi .

  • Proton Translocation Assays: Use pH-sensitive fluorescent dyes (like ACMA or pyranine) to monitor proton translocation across proteoliposome membranes.

  • ATP Synthesis Measurement: After reconstitution of the complete ATP synthase complex containing atpB1 into liposomes, generate an artificial proton motive force and measure ATP synthesis using a luciferase-based ATP detection system.

For a complete functional assessment, the reconstituted ATP synthase in liposomes can be subjected to various driving forces (Δψ, ΔpH) to determine the threshold for ATP synthesis, as demonstrated in studies with other bacterial ATP synthases .

How does the membrane topology of atpB1 contribute to proton translocation?

The membrane topology of atpB1 is critical for establishing the proton translocation pathway in ATP synthase. Based on structural studies of homologous ATP synthases:

  • Half-Channels Architecture: AtpB1 forms two offset half-channels that allow protons to enter from one side of the membrane and exit on the other . This arrangement is essential for converting the proton gradient into rotational motion.

  • Critical Residues: Conserved charged residues (particularly arginine and glutamate) within these half-channels facilitate proton movement. These residues form a network that guides protons through the membrane domain.

  • Interaction with c-Ring: AtpB1's internal structure forms a close interface with the rotating c-ring. The c-ring contains ion-binding sites that interact with the half-channels of atpB1 to couple proton translocation to rotation.

Studies with ATP synthases from Bacillus PS3 have shown that proton translocation may be driven by either ΔpH or Δψ alone , suggesting that the structural arrangement of subunit a and the c-ring allows for flexible energy coupling mechanisms.

What residues in atpB1 are critical for ATP synthase function?

Based on conserved features in ATP synthase subunit a proteins, several key residues in atpB1 are predicted to be essential for function:

  • Charged Residues in Transmembrane Helices: Arginine residues (like Arg-210 in E. coli, corresponding position in P. propionicus atpB1) are critical for proton translocation.

  • Helix-Helix Interaction Sites: Residues that facilitate interaction between transmembrane helices maintain the structural integrity of the proton channels.

  • c-Ring Interface Residues: Amino acids that form the interface with the c-ring are crucial for coupling proton movement to mechanical rotation.

  • Conserved Glutamate/Aspartate Residues: These acidic residues often form part of the proton transfer pathway and participate in hydrogen-bonding networks that facilitate proton movement.

Mutation of these critical residues typically results in loss of ATP synthesis activity or disruption of proton translocation, as demonstrated in studies with other bacterial ATP synthases .

How does ATP synthesis in bacterial systems like P. propionicus compare with other organisms?

Bacterial ATP synthases including that of P. propionicus exhibit both similarities and differences compared to those from other domains of life:

FeatureBacterial (F-type)Archaeal (A-type)Mitochondrial (F-type)V-type ATPases
Primary FunctionATP synthesisATP synthesis (most)ATP synthesisATP hydrolysis
Proton/Na+ couplingVariableVariableProtonProton
c-ring size8-15 subunitsVariable (1-13 hairpins)8 subunits6-10 subunits
Threshold for ATP synthesis87-150 mV87-120 mV~180 mVTypically not ATP synthases
Inhibitory mechanismsε subunitVariableIF1 protein-

Bacterial ATP synthases like that of P. propionicus are typically simpler than their mitochondrial counterparts while retaining the core functional features. The primary distinction lies in:

  • The number of subunits comprising the complex

  • The mechanisms regulating ATP synthesis/hydrolysis

  • The energy threshold required for ATP synthesis

Research with various bacterial ATP synthases has shown that the threshold driving force for ATP synthesis can vary significantly, with some bacterial enzymes able to synthesize ATP at lower electrochemical potentials (87-90 mV) compared to others requiring higher potentials (150 mV or more) .

What evolutionary insights can be gained from studying atpB1 and its homologs?

The study of atpB1 from P. propionicus provides valuable evolutionary insights:

  • Evolutionary Conservation: ATP synthase subunit a is highly conserved across bacteria, highlighting its essential role in energy metabolism. The conservation pattern suggests strong selective pressure to maintain its core function.

  • Adaptational Diversity: Despite conservation, variations in subunit a across species reflect adaptations to different energy requirements and environmental conditions.

  • Relationship to V-type ATPases: The structural similarity between F-type ATP synthases (including P. propionicus) and V-type ATPases suggests a common evolutionary origin with subsequent functional divergence .

  • Evolutionary Transition Points: Some archaeal ATP synthases possess unusual c-subunits (with varying numbers of hairpins and ion-binding sites) that represent potential evolutionary transition points between different types of ATP synthases .

The A-type ATP synthases of archaea are evolutionarily more related to V-type ATPases than to F-type ATP synthases, suggesting complex evolutionary relationships between these enzyme families .

How can recombinant atpB1 be used in reconstitution studies to understand ATP synthase assembly and function?

Reconstitution studies using recombinant atpB1 provide valuable insights into ATP synthase assembly and function:

  • Hybrid Complex Construction: Individual components like atpB1 can be combined with subunits from other species to create hybrid complexes. This approach has been used successfully in studies with ATP synthases from A. woodii, where a hybrid rotor consisting of both F-type and V-type c subunits was characterized .

  • Reconstitution Protocol:

    • Purify individual subunits including atpB1

    • Combine in appropriate molar ratios in the presence of lipids and detergent

    • Remove detergent using dialysis or Bio-Beads to form proteoliposomes

    • Verify assembly by biochemical and functional assays

  • Functional Assessment:

    • Generate an artificial proton gradient across the liposome membrane

    • Measure ATP synthesis under various conditions (different pH, ionic strength, membrane potential)

    • Analyze the threshold driving force required for ATP synthesis

Such reconstitution studies have demonstrated that bacterial ATP synthases like that of E. callanderi with V-type c subunits can synthesize ATP at driving forces as low as 87 mV, challenging previous assumptions about the energetic requirements of these enzymes .

What experimental approaches can elucidate the role of atpB1 in proton translocation and energy coupling?

Several advanced experimental approaches can elucidate atpB1's role in proton translocation:

  • Site-Directed Mutagenesis: Systematically mutate conserved residues in atpB1 to identify those critical for proton translocation. Key targets include:

    • Charged residues in transmembrane helices

    • Residues at the interface with the c-ring

    • Residues lining the proposed proton half-channels

  • Cryo-EM Structural Analysis: High-resolution structural determination of the ATP synthase complex containing atpB1 can reveal:

    • The precise arrangement of transmembrane helices

    • The architecture of proton half-channels

    • Conformational changes during the catalytic cycle

  • Single-Molecule FRET Studies: Introduce fluorescent labels at strategic positions in atpB1 and other subunits to monitor real-time conformational changes during proton translocation.

  • Proton Translocation Assays: Use pH-sensitive probes to directly measure proton movement in reconstituted proteoliposomes under varying conditions:

    • Different driving forces (Δψ, ΔpH)

    • Various inhibitors

    • Mutant variants of atpB1

Studies with ATP synthases from Bacillus PS3 have shown that proton translocation can be driven by either ΔpH or Δψ alone , providing a framework for similar investigations with the P. propionicus enzyme.

How can atpB1 research contribute to the development of novel ATP synthase inhibitors with potential antimicrobial applications?

Research on atpB1 and related ATP synthase components can significantly contribute to antimicrobial drug development:

  • Target Identification: Understanding the structure and function of bacterial ATP synthase components like atpB1 can reveal unique features that distinguish them from human ATP synthases, providing selective targets for inhibition.

  • Inhibitor Screening Approaches:

    • Structure-based virtual screening against the atpB1 binding site

    • High-throughput biochemical assays with reconstituted ATP synthase

    • Phenotypic screening of compound libraries against bacteria

  • Known ATP Synthase Inhibitors as Templates:
    Several inhibitors target different components of ATP synthase and provide starting points for development:

    • DCCD targets the c-subunit by binding to conserved carboxylic acid residues

    • Piceatannol interacts with the pocket created by subunits α, β, and γ

    • Resveratrol inhibits the ATP synthase by a similar mechanism to piceatannol

  • Synergistic Approaches: ATP synthase inhibitors can be used in combination with existing antibiotics to enhance efficacy:

    • ATP depletion sensitizes bacteria to other antimicrobials

    • Dual targeting can reduce the emergence of resistance

The bedaquiline example demonstrates the clinical potential of ATP synthase inhibitors, as it is effective against Mycobacterium tuberculosis by targeting the ATP synthase .

What strategies can overcome common challenges in expressing and purifying functional atpB1?

Several strategies can address common challenges in working with membrane proteins like atpB1:

  • Low Expression Levels:

    • Use specialized expression strains (C41/C43, derived from BL21)

    • Optimize codon usage for E. coli

    • Use stronger promoters or increase cell density before induction

    • Express as fusion protein with solubility-enhancing partners

  • Protein Aggregation:

    • Lower expression temperature (16-20°C)

    • Reduce inducer concentration

    • Include membrane-protein-specific chaperones

    • Screen different detergents for solubilization

  • Poor Solubilization:

    • Test a panel of detergents (DDM, LMNG, digitonin)

    • Optimize detergent:protein ratio

    • Adjust ionic strength and pH of buffer

    • Consider using lipid-detergent mixed micelles

  • Protein Instability:

    • Include stabilizing additives (glycerol, specific lipids)

    • Avoid freeze-thaw cycles

    • Store at appropriate temperature (-20°C/-80°C)

    • Use freshly prepared protein for functional studies

For recombinant atpB1, storage in Tris-based buffer with 50% glycerol at -20°C/-80°C is recommended, with aliquoting to avoid repeated freeze-thaw cycles .

How can researchers address challenges in reconstituting functional ATP synthase complexes containing atpB1?

Reconstitution of functional ATP synthase complexes containing atpB1 presents several challenges:

  • Protein-to-Lipid Ratio Optimization:

    • Test various protein:lipid ratios (typically 1:50 to 1:200 w/w)

    • Screen different lipid compositions (E. coli lipids, POPC/POPG mixtures)

    • Adjust reconstitution buffer conditions (pH, salt concentration)

  • Orientation Control:

    • Use rapid dilution or dialysis methods to favor unidirectional incorporation

    • Include small amounts of charged lipids to influence orientation

    • Verify orientation using protease protection assays or antibody accessibility

  • Functional Verification:

    • Assess proton/sodium translocation using fluorescent probes

    • Measure ATP synthesis in response to artificial ion gradients

    • Compare activities with established bacterial ATP synthases

  • Troubleshooting Low Activity:

    • Verify complete incorporation of all subunits

    • Ensure integrity of the proton gradient (use ionophores as controls)

    • Optimize buffer conditions (including Mg²⁺ concentration)

    • Check for inhibitory contaminants

Successful reconstitution has been demonstrated for several bacterial ATP synthases, including those from E. callanderi, allowing measurement of ATP synthesis at varying driving forces .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.