Recombinant Pelobacter propionicus ATP synthase subunit a 2 (atpB2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

atpB2 encodes the F₀ sector subunit a 2 of the ATP synthase complex in P. propionicus. Key attributes include:

AttributeDetailsSource
Gene NameatpB2
LocusPpro_0848
UniProt IDA1AMA7
Protein Length228 amino acids (aa)
Expression HostEscherichia coli
TagN-terminal His tag

The recombinant protein is expressed as a full-length construct (1–228 aa) and purified using affinity chromatography due to the His tag .

Research Applications

Recombinant atpB2 is utilized in studies targeting bacterial energy metabolism and syntrophic processes:

  1. ATP Synthase Assembly: Investigating subunit interactions in the F₀ sector using cryo-EM .

  2. Proton Translocation: Measuring proton flux kinetics in lipid bilayer systems .

  3. Metabolic Pathway Analysis: Elucidating P. propionicus’ fermentation pathways (e.g., 2,3-butanediol metabolism) .

  4. Lateral Gene Transfer: Analyzing horizontal transfer of ATP synthase genes in Geobacteraceae .

Evolutionary Context

P. propionicus evolved from respiratory ancestors to occupy fermentative and syntrophic niches, acquiring genes like atpB2 through vertical inheritance and lateral transfer . Its ATP synthase is adapted to anaerobic conditions, enabling survival in low-energy environments .

Table 2: Gene Orthologs

OrganismLocusUniProt IDSequence Identity
Geobacter sulfurreducensGSU0848N/A65%
Desulfuromonas acetoxidansDac_0848N/A60%

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. To enhance long-term storage at -20°C/-80°C, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution. Our default final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
atpB2; Ppro_0848; ATP synthase subunit a 2; ATP synthase F0 sector subunit a 2; F-ATPase subunit 6 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Target Names
atpB2
Target Protein Sequence
MLETTQALFHLGPLAVGTTVVTTWGIMVVLSLGAWLASRRLRLDPGPFQVALEGVVQTIR AAVEEVVPRRADTVFPFVATLWLFIGIANLSSLIPRVHSPTADLSATTALALLVFFSVHW FGIRIQGLRPYLRHYLSPSPFLLPFHVIGEITRTLALAVRLFGNMMSLETAALLVLLVAG LFAPIPLLMLHIVEALVQAYIFGMLTLVYIAGAIQSLEARRSPKEEET
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Pelobacter propionicus ATP synthase subunit a 2?

Pelobacter propionicus ATP synthase subunit a 2 (atpB2) is a 228-amino acid transmembrane protein component of the F₀ sector of ATP synthase. It functions as part of the membrane-embedded portion of the ATP synthase complex, facilitating proton translocation across the membrane. The protein contains hydrophobic regions that anchor it within the membrane, allowing it to participate in creating the proton channel necessary for ATP synthesis. The full amino acid sequence is: MLETTQALFHLGPLAVGTTVVTTWGIMVVLSLGAWLASRRLRLDPGPFQVALEGVVQTIRAAVEEVVPRRADTVFPFVATLWLFIGIANLSSLIPRVHSPTADLSATTALALLVFFSVHWFGIRIQGLRPYLRHYLSPSPFLLPFHVIGEITRTLALAVRLFGNMMSLETAALLVLLVAGLFAPIPLLMLHIVEALVQAYIFGMLTLVYIAGAIQSLEARRSPKEEET . This sequence reveals multiple transmembrane helices characteristic of F-type ATP synthase subunit a proteins.

How is recombinant atpB2 typically expressed and purified for research applications?

Recombinant atpB2 is typically expressed in E. coli expression systems using a plasmid vector containing the atpB2 gene fused to an N-terminal His-tag for purification purposes. The protein is expressed under controlled conditions, often using IPTG induction for T7-based expression systems. After cell lysis, the membrane fraction containing the expressed protein is solubilized using appropriate detergents that maintain protein integrity while extracting it from the membrane environment. Purification is performed via immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag, followed by size exclusion chromatography to ensure high purity. The purified protein shows greater than 90% purity as determined by SDS-PAGE analysis . For long-term storage, the protein is typically lyophilized and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for stability.

What are the optimal storage and handling conditions for recombinant atpB2?

Optimal storage and handling of recombinant atpB2 protein requires careful attention to temperature and buffer conditions. The lyophilized protein should be stored at -20°C to -80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of functionality . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) added for long-term storage stability. The reconstituted protein is typically maintained in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maximize stability . When handling the protein for experimental purposes, it is advisable to work at 4°C whenever possible to minimize degradation.

How does the structure of atpB2 compare with ATP synthase subunits from other bacterial species, and what implications does this have for functional studies?

The structure of atpB2 from Pelobacter propionicus shows both conserved features and unique characteristics when compared to ATP synthase subunits from other bacterial species. While maintaining the core functional elements necessary for proton translocation, atpB2 exhibits specific amino acid variations that may reflect adaptations to Pelobacter's metabolic needs. Comparing atpB2 with ATP synthase subunits from organisms like Pseudomonas aeruginosa reveals significant differences in hydrophobic pockets and binding sites. For instance, P. aeruginosa ATP synthase has a more non-polar binding pocket due to the presence of phenylalanine residues in place of aspartate residues found in other species . These structural differences have significant implications for functional studies, particularly when designing inhibitors or conducting comparative analyses of ATP synthase function across species.

Researchers investigating atpB2 function should consider these structural differences when designing experiments, especially when applying findings from model organisms to Pelobacter. Molecular dynamics simulations and structural modeling approaches are recommended to predict how these differences might affect proton translocation efficiency, protein-protein interactions within the ATP synthase complex, and sensitivity to inhibitors. Mutational analyses targeting specific residues unique to atpB2 could provide valuable insights into structure-function relationships specific to Pelobacter propionicus.

What methodological approaches are most effective for studying the interaction between atpB2 and other subunits in the ATP synthase complex?

Studying interactions between atpB2 and other ATP synthase subunits requires a multifaceted approach combining biochemical, biophysical, and structural biology techniques. Co-immunoprecipitation assays using antibodies against atpB2 or its interaction partners can identify protein-protein interactions within the complex. For more detailed characterization, crosslinking mass spectrometry (XL-MS) is particularly effective for mapping specific interaction sites between atpB2 and other subunits, especially the interface with subunit c, which forms a critical part of the proton channel .

Surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) provide quantitative measurements of binding affinities and thermodynamic parameters of these interactions. For structural characterization, cryo-electron microscopy has emerged as the method of choice for visualizing the entire ATP synthase complex with atpB2 in its native environment. Complementary techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational changes and solvent accessibility of different regions of atpB2 during interaction with other subunits. Functional studies should incorporate liposome reconstitution assays where purified atpB2 and other subunits are incorporated into artificial membrane vesicles to measure proton translocation activity and its coupling to ATP synthesis.

How can researchers effectively analyze the impact of the [ATP]/[ADP] ratio on ATP synthase function in systems expressing recombinant atpB2?

The intracellular [ATP]/[ADP] ratio significantly impacts ATP synthase function, making it a critical parameter in studies involving recombinant atpB2. Researchers should employ a systems biology approach that combines targeted metabolomics with transcriptomic and proteomic analyses. High-performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC-MS) techniques can accurately measure intracellular ATP and ADP concentrations with high sensitivity . Stable isotope labeling with amino acids in cell culture (SILAC) combined with mass spectrometry provides quantitative data on how changes in the [ATP]/[ADP] ratio affect protein expression patterns, including potential regulatory feedback on ATP synthase components.

To manipulate the [ATP]/[ADP] ratio experimentally, researchers can employ genetic approaches such as modifying ATP-consuming or ATP-producing pathways. For instance, deleting portions of the operon encoding the soluble F1-ATPase can disrupt the energy balance within the cell . Alternatively, pharmacological approaches using specific inhibitors of respiratory chain components or uncouplers can alter the proton gradient driving ATP synthesis. Real-time monitoring of the [ATP]/[ADP] ratio can be achieved using genetically encoded fluorescent biosensors, which allow spatiotemporal resolution of energy status changes within living cells. Integrating these data with RT-qPCR analysis of genes involved in central carbon metabolism, respiratory chain function, and stress response pathways provides a comprehensive understanding of how energy status impacts cellular physiology in systems expressing recombinant atpB2 .

What strategies can be employed to optimize the functional reconstitution of atpB2 in artificial membrane systems?

Functional reconstitution of atpB2 in artificial membrane systems presents significant challenges due to its hydrophobic nature and complex structural requirements. Successful reconstitution strategies begin with careful selection of lipid composition to mimic the native membrane environment of Pelobacter propionicus. A mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin in ratios similar to bacterial inner membranes typically provides a good starting point. The choice of detergent for solubilization is critical; mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are preferred to maintain protein integrity.

The reconstitution process should follow a step-wise approach: first, solubilized atpB2 is mixed with detergent-destabilized liposomes; then, controlled detergent removal is achieved using bio-beads, dialysis, or gel filtration. The protein-to-lipid ratio requires optimization, typically starting with molar ratios between 1:1000 and 1:10000. To assess successful incorporation and orientation, researchers can employ freeze-fracture electron microscopy or fluorescence quenching assays using labeled proteins. Functional validation should include proton pumping assays using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) or measurement of ATP synthesis activity when reconstituted with other ATP synthase components. Co-reconstitution with atpE2 (subunit c) is particularly important as these subunits together form the critical proton channel necessary for ATP synthesis .

How can researchers differentiate between the roles of atpB2 and other ATP synthase subunits in energy metabolism studies?

Differentiating between the specific roles of atpB2 and other ATP synthase subunits requires sophisticated genetic and biochemical approaches. CRISPR-Cas9 gene editing can create precise deletions or modifications of the atpB2 gene to assess its specific contribution to ATP synthase function. Complementation studies, where mutant strains are transformed with plasmids expressing wild-type or modified versions of atpB2, can confirm phenotypic observations and rule out polar effects. Selective inhibition using subunit-specific antibodies or custom-designed inhibitors can temporarily block atpB2 function without affecting other subunits.

For biochemical differentiation, researchers can employ in vitro reconstitution experiments with purified components, systematically omitting or modifying specific subunits to assess their individual contributions to proton translocation and ATP synthesis. Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy can monitor conformational changes in specific regions of atpB2 during the catalytic cycle. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides information on solvent accessibility and structural dynamics of different subunits under various conditions. Cross-linking experiments coupled with mass spectrometry can map the interaction network between atpB2 and other subunits, revealing how these interactions change during different functional states of the ATP synthase complex.

What are the key considerations when designing studies to investigate atpB2 inhibitors as potential antibacterial agents?

Designing studies to investigate atpB2 inhibitors requires careful consideration of several critical factors. First, researchers must establish robust in vitro assays to measure ATP synthase activity in the presence of potential inhibitors. These assays should quantify both ATP synthesis and proton translocation to fully characterize inhibitor mechanisms. Structure-based drug design approaches should leverage available structural information on ATP synthase binding pockets, focusing on the unique features of atpB2 compared to homologs in other species .

Selectivity profiling is essential to identify compounds that specifically target bacterial ATP synthase without affecting human mitochondrial ATP synthase. This requires parallel testing against purified human ATP synthase or mitochondrial preparations. Medicinal chemistry optimization should focus on improving both potency and physicochemical properties needed for bacterial penetration, particularly considering the challenges posed by the outer membrane of Gram-negative bacteria . When evaluating compounds in cellular systems, researchers should employ membrane potential assays using fluorescent dyes like DiSC3(5) to confirm the mechanistic action of potential inhibitors on membrane energetics.

What methodological approaches can be used to study the post-translational modifications of atpB2 and their functional significance?

Post-translational modifications (PTMs) of atpB2 represent an understudied area that may significantly impact its function and regulation. Mass spectrometry-based proteomics offers the most comprehensive approach for identifying PTMs on atpB2. Bottom-up proteomics using multiple proteases can maximize sequence coverage, while top-down proteomics preserves information about co-occurring modifications. Enrichment strategies for specific modifications (phosphorylation, acetylation, etc.) can enhance detection sensitivity.

Site-directed mutagenesis creating non-modifiable variants (e.g., Ser to Ala to prevent phosphorylation) allows functional assessment of specific modifications. These variants should be evaluated using ATP synthesis assays, proton translocation measurements, and growth phenotype analyses under various stress conditions. Temporal dynamics of PTMs can be monitored using pulse-chase experiments combined with immunoprecipitation and mass spectrometry, revealing how modifications change in response to environmental or metabolic shifts.

Structural impacts of PTMs can be assessed using hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes induced by modifications. Computational molecular dynamics simulations can predict how specific PTMs might affect protein-protein interactions or proton channel characteristics. Researchers should also investigate the enzymes responsible for adding or removing these modifications using inhibitor studies or genetic approaches to manipulate the levels of specific modifying enzymes.

Table 1: Characteristics of Recombinant Pelobacter propionicus ATP synthase subunit a 2 (atpB2)

ParameterDetailsReference
UniProt IDA1AMA7
Protein Length228 amino acids (Full Length)
Expression SystemE. coli
TagN-terminal His tag
Molecular Weight~25 kDa (approximate)
Storage FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C
Purity>90% by SDS-PAGE

Table 2: Comparison of ATP Synthase Subunit Features Between Different Bacterial Species

FeaturePelobacter propionicus (atpB2)Pseudomonas aeruginosaFunctional Implication
Binding PocketModerately hydrophobicHighly non-polar due to Phe instead of AspAffects inhibitor binding specificity
Steric ConstraintsLess restrictiveMore constrainedInfluences substrate and inhibitor access
Key ResiduesContains essential residues for proton translocationContains Phe, Thr, Met, and Val at key positionsDetermines proton channel properties
π-stacking CapabilityPresentEnhanced due to multiple aromatic residuesAffects protein-protein interactions and stability

What strategies can address poor expression yields of recombinant atpB2 in E. coli systems?

Poor expression yields of recombinant atpB2 in E. coli frequently challenge researchers due to the hydrophobic nature of this membrane protein. Optimizing expression involves systematically modifying several parameters. First, selecting specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), can significantly improve yields. These strains are adapted to tolerate the toxic effects often associated with overexpression of membrane proteins. Second, expression vector selection should prioritize tightly regulated promoters that prevent leaky expression, while codon optimization of the atpB2 gene for E. coli can resolve translation inefficiencies.

Cultivation conditions substantially impact expression success. Lower growth temperatures (16-25°C rather than 37°C) slow protein synthesis, allowing proper membrane insertion and folding. Inducer concentration optimization is critical—excessive induction can overwhelm the membrane protein insertion machinery. Supplementing growth media with specific lipids or using enriched media like Terrific Broth can provide necessary building blocks for membrane expansion. For detection and purification, consider using alternative tags such as Strep-tag II or FLAG if the His-tag affects protein folding or function. If standard expression methods continue to yield poor results, cell-free expression systems represent an alternative that bypasses cellular toxicity issues while allowing direct incorporation into artificial liposomes.

How can researchers effectively troubleshoot inconsistent results in ATP synthase activity assays using recombinant atpB2?

Inconsistent results in ATP synthase activity assays using recombinant atpB2 often stem from multiple technical and biological factors. Protein quality control is paramount—researchers should verify protein integrity before each experiment using analytical size exclusion chromatography to detect aggregation, and circular dichroism to confirm proper secondary structure. Batch-to-batch variation can be minimized by standardizing purification protocols and establishing quality control checkpoints with defined acceptance criteria.

Assay conditions require careful standardization, particularly pH, temperature, and ionic strength, which significantly affect ATP synthase activity. The lipid environment is critical for proper function—researchers should standardize liposome composition and preparation methods, considering that lipid purity and oxidation status can dramatically impact results. When reconstituting atpB2 with other ATP synthase subunits, maintaining consistent stoichiometry is essential. Proton gradient stability across experiments can be ensured by using internal controls like valinomycin/nigericin calibration curves.

Detection methods also influence consistency—absorbance-based ATP detection methods may be subject to interference, whereas luciferase-based assays provide higher sensitivity but can be affected by assay components. Implementing appropriate controls with each experiment, including enzyme-free controls, inhibitor controls (e.g., oligomycin or DCCD), and positive controls using well-characterized ATP synthase preparations, helps identify potential sources of variability. Finally, researchers should consider the orientation of atpB2 in reconstituted systems, as random orientation can lead to only a fraction of the protein contributing to measured activity.

What emerging technologies show promise for advancing research on atpB2 and other ATP synthase components?

Emerging technologies are poised to revolutionize research on atpB2 and other ATP synthase components. Cryo-electron tomography now enables visualization of ATP synthase in its native membrane environment at near-atomic resolution, providing unprecedented insights into the structural arrangement and conformational dynamics of atpB2 within the complete ATP synthase complex. AlphaFold and other AI-based prediction tools can model protein-protein interactions between atpB2 and other subunits with increasing accuracy, generating testable hypotheses about critical interaction interfaces.

Single-molecule techniques, including high-speed atomic force microscopy and single-molecule FRET, allow real-time observation of ATP synthase rotational dynamics and conformational changes during catalysis. These approaches can reveal how atpB2 participates in proton translocation at the molecular level. Microfluidic devices coupled with advanced imaging techniques enable the study of ATP synthase function in controlled lipid environments with precise manipulation of proton gradients and substrate concentrations.

CRISPR-based approaches for in situ protein tagging and genome-wide interaction screens can identify novel interaction partners and regulatory factors affecting atpB2 function. Expansion microscopy combined with super-resolution techniques may reveal the spatial organization of ATP synthase complexes in bacterial membranes with unprecedented detail. Looking forward, the integration of these technologies with computational modeling will likely provide a comprehensive understanding of how atpB2 and the entire ATP synthase complex function within the broader context of cellular energetics.

How might research on atpB2 contribute to our understanding of bacterial bioenergetics and potential antimicrobial strategies?

Research on atpB2 has significant implications for advancing our understanding of bacterial bioenergetics and developing novel antimicrobial strategies. As a key component of the ATP synthase proton channel, atpB2 plays a critical role in energy conservation across diverse bacterial species. Detailed structural and functional characterization of atpB2 can reveal species-specific adaptations in energy coupling mechanisms, particularly in metabolically diverse organisms like Pelobacter propionicus. These insights contribute to our fundamental understanding of how bacteria have evolved diverse strategies for energy conservation in different ecological niches.

From an antimicrobial perspective, ATP synthase inhibitors targeting bacterial-specific features of atpB2 represent a promising approach for new antibiotic development . The recent success of bedaquiline against Mycobacterium tuberculosis demonstrates the clinical potential of ATP synthase inhibitors. Structure-guided design of inhibitors specifically targeting unique features of bacterial atpB2 (compared to human mitochondrial ATP synthase) could lead to broad-spectrum antibiotics with minimal host toxicity. Additionally, understanding how bacteria regulate ATP synthase assembly and function under various stress conditions may reveal vulnerabilities that could be exploited therapeutically.

The evolutionary conservation yet species-specific variations in atpB2 make it an excellent model for studying how essential cellular machinery adapts to different physiological demands. Comparative studies across diverse bacterial phyla can provide insights into the co-evolution of energy conservation systems with metabolic capabilities. Furthermore, understanding how ATP synthase components like atpB2 interact with other cellular systems during energy limitation or environmental stress could reveal novel targets for combination antimicrobial therapies that simultaneously attack energy production and stress response mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.