Recombinant Pelobacter propionicus ATP synthase subunit a 3 (atpB3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please communicate them to us. We will prioritize developing the specified tag.
Synonyms
atpB3; Ppro_1500; ATP synthase subunit a 3; ATP synthase F0 sector subunit a 3; F-ATPase subunit 6 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Target Names
atpB3
Target Protein Sequence
MVHPFLFLEFLRKMLAPLHLSEASADAVSYTWLIIALLLLLSFLATRALKTVPGGLQNFM EIIVGGIENMVTETMGEHGRPYFPLVATIGIFVLVSNLIGLIPGFFPPTANINTTAACAI VVFLSTHVVGIKRHGIGYIKHFCGPILWLTPIMFFIEVIGHLSRPVSLTLRLFGNMNGHE LVLIIFFGLAPFLVPLPMMLMGVLVSFIQAFVFMLLTMIYIQGSLEEAH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a 3 (atpB3) and what is its role in Pelobacter propionicus?

ATP synthase subunit a 3 (atpB3) is a component of the F0 sector of ATP synthase in Pelobacter propionicus, a Gram-negative, strictly anaerobic, non-spore-forming bacterium that ferments 2,3-butanediol and acetoin . ATP synthases function by producing ATP from ADP and inorganic phosphate using energy derived from a transmembrane proton motive force (PMF) . The subunit a is specifically part of the membrane-embedded, proton-conducting portion of the ATP synthase complex, playing a crucial role in the translocation of protons across the membrane. In bacterial ATP synthases like that of P. propionicus, the H⁺-translocating F0 domain contains subunits a and c that use the proton motive force to drive rotation of the central stalk subunits . This rotational energy is then transmitted to the catalytic α3:β3-headpiece where ADP is phosphorylated to form ATP. The specific role of subunit a includes forming part of the proton channel and interacting with the c-ring to facilitate the conversion of proton flow into rotational motion.

How does atpB3 compare with ATP synthase components from other bacterial species?

While specific comparative data for P. propionicus atpB3 is limited, insights can be drawn from studies of other bacterial ATP synthases. Bacterial ATP synthases, including those from Bacillus PS3 and E. coli, share similar core architectures despite species-specific variations . The membrane region of bacterial ATP synthases performs the same core functions as their more complex mitochondrial counterparts but with a simpler structure . In Bacillus PS3, the peripheral stalk (which includes subunits b and δ) is structurally simpler and more flexible than in yeast mitochondria, suggesting that hydrophobic interactions between subunit a and the c-ring, rather than the peripheral stalk, maintain the integrity of the F0 region . Different bacterial species also show variations in regulatory mechanisms. For instance, in Mycobacterium species, specific modifications such as the αCTD (C-terminal domain), an inserted δ-domain, or an extra γ-loop contribute to ATP hydrolysis inhibition and ATP formation . These structural differences likely reflect adaptations to different environmental niches and metabolic requirements.

What are the optimal expression and purification strategies for recombinant P. propionicus atpB3?

Based on current research practices with similar recombinant proteins, expressing P. propionicus atpB3 in E. coli offers a balance of yield and proper folding . For optimal expression, researchers should consider using BL21(DE3) or similar strains designed for recombinant protein expression, combined with vectors containing strong inducible promoters like T7. The addition of fusion tags (His-tag, GST, or similar) can facilitate purification while potentially enhancing solubility. Expression conditions should be optimized through systematic testing of induction timing, temperature, and inducer concentration. For purification, a multi-step approach is recommended: initial capture via affinity chromatography (if tagged), followed by ion-exchange chromatography and gel filtration to achieve high purity. For membrane proteins like atpB3, detergent selection is critical—mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin may preserve native-like structure. The final purified protein should undergo verification via SDS-PAGE, Western blot, and mass spectrometry to confirm identity and purity greater than 85% . Post-purification stability assessment through dynamic light scattering or thermal shift assays can provide valuable information about protein quality prior to downstream applications.

How can researchers effectively investigate the proton translocation mechanism of P. propionicus atpB3?

Investigating the proton translocation mechanism requires sophisticated experimental approaches combining structural, functional, and computational methods. Researchers should consider reconstituting purified atpB3 into proteoliposomes to create a controlled membrane environment for functional studies. Proton translocation can be measured directly using pH-sensitive fluorescent dyes (like ACMA or pyranine) incorporated into these proteoliposomes, allowing real-time monitoring of proton movement in response to membrane potential changes. Site-directed mutagenesis of conserved residues within the predicted proton channel can help identify critical amino acids involved in proton translocation. Based on studies of other bacterial ATP synthases, residues in transmembrane helices that face the c-ring are particularly important candidates . Complementary approaches include hydrogen/deuterium exchange mass spectrometry to map solvent-accessible regions and cryo-electron microscopy to determine high-resolution structures in different functional states. The structures of ATP synthases from Bacillus PS3 have revealed the path of transmembrane proton translocation, providing a model for understanding the roles of specific residues in this mechanism . Computational molecular dynamics simulations can further elucidate the energetics and kinetics of proton movement through the a-subunit/c-ring interface.

What role does atpB3 play in the regulation of ATP synthesis versus hydrolysis in P. propionicus?

The role of atpB3 in regulating the directionality of ATP synthase function likely involves complex interactions with other subunits within the enzyme complex. From studies of other bacterial ATP synthases, we know that the direction of rotation (synthesis vs. hydrolysis) is influenced by the proton motive force, ATP concentration, and regulatory mechanisms involving multiple subunits . In Bacillus PS3, subunit ε mediates inhibition of ATP hydrolysis in a manner dependent on free ATP concentration, with low ATP promoting the inhibitory "up" conformation and high ATP inducing a permissive "down" conformation . This mechanism prevents wasteful ATP hydrolysis when cellular energy is limited. The subunit a (including atpB3 in P. propionicus) works in concert with this regulatory system by forming part of the proton pathway that drives rotation in the synthesis direction when proton motive force is sufficient. To investigate this role specifically in P. propionicus, researchers would need to reconstitute the complete ATP synthase complex and measure ATP synthesis and hydrolysis activities under varying conditions of proton motive force and ATP concentration. Comparing the behavior of wild-type atpB3 with site-directed mutants could reveal specific residues involved in directional regulation.

What are the recommended storage and handling protocols for recombinant P. propionicus atpB3?

The optimal storage and handling of recombinant P. propionicus atpB3 depends on its formulation and intended use. For the liquid form, storage at -20°C/-80°C provides a shelf life of approximately 6 months, while the lyophilized form can maintain stability for up to 12 months at the same temperatures . Researchers should note that the actual shelf life varies based on buffer composition, storage conditions, and the intrinsic stability of the protein itself . For working with the protein, it is strongly recommended to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and activity loss . Working aliquots should be stored at 4°C and used within one week . Before opening, vials should be briefly centrifuged to bring contents to the bottom . The recommended reconstitution protocol involves using deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50% final concentration) for long-term storage aliquots . A default final concentration of 50% glycerol is suggested as a starting point . For functional studies, researchers should consider buffer optimization through thermal shift assays or activity measurements to identify conditions that maximize stability and activity.

How should researchers design experiments to investigate atpB3 interactions with other ATP synthase subunits?

Investigating protein-protein interactions within the ATP synthase complex requires a multi-faceted approach. The following experimental design strategies are recommended based on current research practices with ATP synthases:

TechniqueAdvantagesLimitationsData Output
Co-immunoprecipitationDetects native interactionsRequires specific antibodiesQualitative binding
Pull-down assaysWorks with recombinant tagged proteinsMay detect non-physiological interactionsSemi-quantitative binding
Crosslinking coupled with mass spectrometryMaps interaction interfacesChemical modification may alter structureResidue-level interaction maps
Förster resonance energy transfer (FRET)Real-time interaction dynamicsRequires fluorescent labelingQuantitative binding kinetics
Surface plasmon resonanceLabel-free quantitative analysisRequires immobilization of one partnerAffinity and kinetic constants
Cryo-electron microscopyVisualizes entire complexRequires homogeneous samples3D structural models

When designing these experiments, researchers should express not only atpB3 but also potential interaction partners (particularly c-ring subunits and other F0 components). Constructs should be designed to include appropriate tags for detection and purification while minimizing interference with native interactions. Controls should include non-interacting proteins to confirm specificity and, where possible, known mutations that disrupt interactions based on homologous proteins. The investigation should focus particularly on interactions between atpB3 and the c-ring, as these are critical for proton translocation based on studies of other bacterial ATP synthases .

What reconstitution methods are most effective for functional studies of atpB3?

For functional studies of atpB3, effective reconstitution into a membrane environment is crucial. Based on established protocols for membrane proteins, the following methodologies are recommended:

  • Proteoliposome Reconstitution: This involves incorporating purified atpB3 into liposomes composed of phospholipids that mimic the bacterial membrane composition. Researchers should:

    • Select lipids that match the native membrane environment of P. propionicus

    • Determine optimal protein-to-lipid ratios through systematic testing (typically 1:50 to 1:200 w/w)

    • Use detergent removal methods such as dialysis, gel filtration, or biobeads for gentle reconstitution

    • Verify reconstitution success through sucrose gradient centrifugation and freeze-fracture electron microscopy

  • Nanodiscs Reconstitution: This approach uses membrane scaffold proteins to create disc-like lipid bilayers containing atpB3:

    • Provides more controlled and homogeneous membrane environments

    • Allows precise control of oligomeric state

    • Facilitates structural studies by creating monodisperse particles

    • Compatible with a wider range of biophysical techniques

  • Co-reconstitution with Partner Subunits: For functional studies, reconstituting atpB3 together with other F0 subunits (particularly c-ring components) is essential:

    • Express and purify partner subunits with compatible tags

    • Optimize reconstitution buffer conditions (pH, ionic strength, specific ions)

    • Verify complex formation through native gel electrophoresis or analytical ultracentrifugation

    • Assess functional activity through proton pumping assays or ATP synthesis/hydrolysis measurements

The reconstituted systems can then be used for functional assays including proton translocation measurements, ATP synthesis activity, and rotational dynamics studies using techniques such as single-molecule FRET or high-speed atomic force microscopy.

How does P. propionicus atpB3 compare with homologous proteins from other bacterial species in structure and function?

While specific structural data for P. propionicus atpB3 is limited, comparative analysis can be informed by studies of homologous proteins in other bacteria. ATP synthase subunit a performs similar core functions across bacterial species, but with species-specific adaptations. Based on available research:

SpeciesKey Structural FeaturesFunctional CharacteristicsRegulatory Mechanisms
P. propionicus atpB3Partial protein structure available Part of F0 sector, involved in proton translocationUnknown specific regulatory features
Bacillus PS3Complete atomic models in three rotational states Clear proton translocation pathwaySubunit ε mediates ATP-dependent inhibition
E. coliWell-characterized transmembrane helicesPersistent inhibition of ATP hydrolysis without sufficient PMF Differs from Bacillus PS3 in subunit ε regulation
Mycobacterium spp.Contains species-specific modificationsEnhanced latent ATP hydrolysis inhibitionFeatures unique αCTD, inserted δ-domain, and extra γ-loop

The architecture of the membrane region in bacterial ATP synthases allows them to perform the same core functions as their more complex mitochondrial counterparts but with a simpler structure . Studies of Bacillus PS3 ATP synthase have revealed the path of transmembrane proton translocation, providing a model for understanding the roles of specific residues in this mechanism . These comparisons suggest that while the fundamental mechanism of proton translocation through subunit a is likely conserved in P. propionicus, there may be species-specific adaptations related to its anaerobic lifestyle and energy metabolism requirements.

What unique features distinguish P. propionicus ATP synthase from other bacterial ATP synthases?

Pelobacter propionicus possesses several distinctive characteristics that likely influence the structure and function of its ATP synthase, including atpB3. As a strictly anaerobic bacterium that ferments 2,3-butanediol and acetoin , P. propionicus operates in energy-limited environments, which may require specialized adaptations in its ATP synthase. While specific unique features of P. propionicus atpB3 are not explicitly detailed in the available literature, several potential distinguishing characteristics can be inferred based on its ecological niche and phylogeny:

  • Phylogenetic Context: P. propionicus belongs to the phylum Thermodesulfobacteriota , which may confer structural variations compared to more commonly studied ATP synthases from Proteobacteria (E. coli) or Firmicutes (Bacillus).

  • Anaerobic Adaptation: As a strict anaerobe, its ATP synthase likely operates with smaller proton gradients than those of facultative or aerobic bacteria, potentially requiring higher efficiency of proton utilization.

  • Multiple atpB Genes: The designation "atpB3" suggests multiple versions of this subunit, which could indicate specialized roles for different environmental conditions or metabolic states.

  • Potential Regulatory Mechanisms: The anaerobic fermentation lifestyle may necessitate tight regulation of ATP synthesis versus hydrolysis, possibly through unique structural elements or regulatory interactions.

Detailed structural and functional studies comparing P. propionicus atpB3 with homologs from diverse bacterial species would be needed to fully characterize these potential distinguishing features. Such research would contribute valuable insights into the adaptation of ATP synthases to specific ecological niches and metabolic requirements.

What are common challenges in working with recombinant P. propionicus atpB3 and how can they be addressed?

Researchers working with recombinant P. propionicus atpB3 may encounter several challenges common to membrane protein studies. Based on research practices with similar proteins, the following issues and solutions are recommended:

ChallengePossible CausesRecommended Solutions
Low expression yieldsToxicity to host cells; formation of inclusion bodiesOptimize induction conditions (lower temperature, reduced inducer concentration); use specialized expression strains; consider fusion partners to enhance solubility
Protein instabilityImproper buffer conditions; detergent-induced destabilizationScreen buffer components systematically (pH, salt, additives); test various detergents at minimal concentrations; add stabilizing lipids
Poor solubilityHydrophobic nature of membrane proteinUse mild detergents like DDM or LMNG; add lipids during purification; consider amphipols or nanodiscs for stabilization
Loss of activityDenaturation during purification; loss of essential lipidsMinimize purification steps; maintain low temperature throughout; supplement with native-like lipids
AggregationConcentration-dependent self-association; improper buffer conditionsInclude glycerol in storage buffer ; reduce protein concentration; optimize ionic strength
Inconsistent reconstitutionVariable detergent removal; lipid composition effectsStandardize reconstitution protocols; carefully control detergent:protein:lipid ratios; verify incorporation using multiple techniques

Additionally, researchers should note that repeated freeze-thaw cycles can significantly reduce protein quality and activity . Aliquoting the protein immediately after purification and storing working stocks at 4°C for no more than one week can help maintain sample integrity . For long-term storage, adding glycerol to a final concentration of 50% before freezing at -20°C/-80°C is recommended . If problems persist, considering alternative constructs (e.g., fusion proteins, truncations guided by bioinformatic analysis) might improve protein behavior.

How can researchers troubleshoot activity assays for atpB3 function?

Troubleshooting activity assays for atpB3 function requires systematic analysis of multiple experimental parameters. Since atpB3 is part of the proton-translocating machinery of ATP synthase, functional assays typically measure either proton translocation directly or its coupling to ATP synthesis/hydrolysis. Common issues and solutions include:

  • No Detectable Activity:

    • Verify protein integrity through circular dichroism or fluorescence spectroscopy

    • Ensure proper membrane reconstitution (check protein orientation and incorporation efficiency)

    • Confirm assay component functionality (substrates, coupling enzymes, detection systems)

    • Test positive controls using well-characterized ATP synthase components

  • Low Activity Levels:

    • Optimize buffer conditions (pH, ionic strength, specific ions like Mg²⁺)

    • Adjust lipid composition to better mimic native environment

    • Check for inhibitory contaminants in protein preparation

    • Ensure sufficient proton motive force in reconstituted systems

  • Variable Results Between Experiments:

    • Standardize protein:lipid ratios in reconstitution

    • Control temperature precisely during assays

    • Prepare fresh reagents and substrates

    • Implement internal standards for normalization

  • Activity Decreases Rapidly:

    • Add stabilizing agents (glycerol, specific lipids)

    • Reduce exposure to extreme pH or temperature

    • Minimize oxidation by adding reducing agents and using degassed buffers

    • Consider time-course measurements to capture initial rates

Based on studies with other bacterial ATP synthases, researchers should note that the functional activity of atpB3 likely depends on its interaction with other ATP synthase subunits, particularly the c-ring components . Therefore, co-reconstitution with these partners may be necessary to observe physiologically relevant activity. Additionally, controlling the orientation of the reconstituted protein in membrane systems is crucial for correctly interpreting proton translocation measurements.

What are promising research avenues for understanding P. propionicus atpB3 role in bacterial energy metabolism?

Several promising research avenues could advance our understanding of P. propionicus atpB3 and its role in bacterial energy metabolism:

  • Structural Biology Approaches:

    • High-resolution structural determination of P. propionicus ATP synthase through cryo-electron microscopy, following approaches used for Bacillus PS3 ATP synthase

    • Comparison of structures in different rotational states to understand the dynamic mechanism of proton translocation

    • Mapping of the proton pathway through the a-subunit/c-ring interface

  • Physiological Role in Anaerobic Metabolism:

    • Investigation of atpB3 expression and activity under different growth conditions relevant to P. propionicus ecology

    • Examination of the relationship between fermentation pathways and ATP synthase function

    • Analysis of how energy limitation in anaerobic environments shapes ATP synthase efficiency

  • Comparative Genomics and Evolution:

    • Phylogenetic analysis of atpB3 across related species to understand evolutionary adaptations

    • Investigation of the significance of multiple atpB genes in P. propionicus (as suggested by the atpB3 designation)

    • Horizontal gene transfer analysis to determine the evolutionary history of this ATP synthase variant

  • Synthetic Biology Applications:

    • Engineering of atpB3 variants with altered properties (efficiency, ion selectivity, regulatory control)

    • Integration of P. propionicus ATP synthase components into synthetic cellular systems

    • Exploration of potential biotechnological applications based on unique properties

These research directions would benefit from interdisciplinary approaches combining structural biology, biochemistry, molecular biology, and systems biology to develop a comprehensive understanding of how P. propionicus ATP synthase contributes to the organism's survival in its ecological niche.

How might research on P. propionicus atpB3 contribute to our broader understanding of ATP synthase evolution and adaptation?

Research on P. propionicus atpB3 offers valuable opportunities to enhance our understanding of ATP synthase evolution and adaptation to specific ecological niches:

  • Evolutionary Adaptation to Anaerobic Environments:

    • P. propionicus, as a strict anaerobe that ferments specific substrates , represents a distinct evolutionary adaptation compared to model organisms like E. coli or Bacillus

    • Studying its ATP synthase could reveal how these essential enzymes adapted to function efficiently with lower proton motive force typical of anaerobic environments

    • Comparative analysis with aerobic and facultative anaerobic bacteria could identify structural and functional adaptations specific to energy-limited lifestyles

  • Phylogenetic Insights:

    • P. propionicus belongs to the phylum Thermodesulfobacteriota , which is less represented in ATP synthase research compared to Proteobacteria or Firmicutes

    • Analysis of its ATP synthase components could fill important gaps in our understanding of the diversity and evolution of these enzymes across bacterial lineages

    • Identification of conserved versus variable regions could highlight functionally critical domains versus those subject to adaptive evolution

  • Molecular Mechanisms of Proton Translocation:

    • Different bacterial species have evolved variations in the proton translocation mechanism while maintaining the core function

    • Structural and functional studies of atpB3 could reveal species-specific adaptations in this critical process

    • Comparison with well-characterized systems like Bacillus PS3 could identify alternative solutions to the same biochemical challenge

  • Regulatory Mechanisms:

    • Different bacterial species show variations in how they regulate ATP synthesis versus hydrolysis

    • Understanding P. propionicus-specific regulatory mechanisms could reveal novel strategies for energy conservation in anaerobic environments

    • This knowledge could inform synthetic biology approaches for creating ATP synthases with tailored regulatory properties

Such research would contribute to a more comprehensive evolutionary model of ATP synthases, moving beyond the current understanding based primarily on model organisms to include the diverse adaptations found across the bacterial domain.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.