Recombinant Pelobacter propionicus Cobalt transport protein CbiM 1 (cbim1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbim1; Ppro_1226; Cobalt transport protein CbiM 1; Energy-coupling factor transporter probable substrate-capture protein CbiM 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Target Names
cbim1
Target Protein Sequence
MHIMEGFLPVEHAIGWSVASAPVVAYGLYSINKKINKNPEQRMLLGVAAAFTFVLSALKM PSVTGSCSHPTGTGLGAILFGPSAVAPIGAVVLLFQALLLAHGGLTTLGANIFSMAIVGP FAAAAVFRLARAARFPFGVGVFLAASLGDLLTYVTTACQLAFAFPDPVGGFTASLAKFAG VFALTQIPLAISEGLLTVVVMNALLRFNREELGSLNIEGNGQEVQA
Uniprot No.

Target Background

Function
This protein is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ, which plays a role in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalt Transport Protein CbiM 1 and what is its function in Pelobacter propionicus?

Cobalt transport protein CbiM 1 (cbim1) is a membrane protein that functions as part of an energy-coupling factor (ECF) transport system in Pelobacter propionicus. This protein specifically serves as a substrate-capture component responsible for binding cobalt ions before their transport across the cell membrane. The protein plays an essential role in cobalt homeostasis, which is critical for various cellular processes including vitamin B12 (cobalamin) biosynthesis and enzymatic functions requiring cobalt as a cofactor. The full-length protein consists of 226 amino acids with a molecular structure optimized for membrane integration and ion binding .

What are the general storage and handling recommendations for recombinant cbim1 protein?

Recombinant cbim1 protein requires specific storage and handling conditions to maintain its structural integrity and functional properties. The protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein stability.

For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% is recommended for long-term storage. The reconstituted protein is typically stable in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose. Prior to opening, vials should be briefly centrifuged to ensure all content is collected at the bottom .

How does the structure of cbim1 compare to other bacterial cobalt transporters, and what implications does this have for metal ion specificity?

The structure of cbim1 from Pelobacter propionicus shares conserved domains with other bacterial cobalt transporters while exhibiting distinct features that impact its metal ion specificity. Analysis of its amino acid sequence reveals multiple transmembrane domains and metal-binding motifs characteristic of the CbiM family of transporters.

The protein contains key structural elements including:

Structural ElementAmino Acid PositionPredicted Function
Transmembrane helix 123-45Membrane anchoring and pore formation
Transmembrane helix 272-94Channel structure
Transmembrane helix 3110-132Ion selectivity
Transmembrane helix 4156-178Conformational changes during transport
Metal-binding domain48-67Cobalt coordination

Unlike zinc or iron transporters, the metal-binding domain of cbim1 contains specific residues optimized for cobalt coordination geometry. These structural features confer selectivity for cobalt over other divalent metals, though some cross-reactivity with nickel ions can occur under certain conditions. Understanding these structural determinants is crucial for research involving metal transport mechanisms and the development of selective inhibitors .

What are the known interaction partners of cbim1 in the ECF transporter complex?

Cobalt transport protein CbiM 1 functions as part of a multi-component Energy-Coupling Factor (ECF) transport complex. Based on studies of homologous systems, cbim1 likely interacts with several protein partners to form a functional transport apparatus:

  • CbiQ - A transmembrane component that forms the translocation channel

  • CbiO - An ATPase subunit that provides energy through ATP hydrolysis

  • CbiN - A small membrane protein that enhances transport efficiency

These interactions form a quaternary complex structure where cbim1 serves as the substrate-binding protein that captures cobalt ions from the extracellular environment. The protein-protein interactions occur primarily through specific transmembrane domains and cytoplasmic loops. Research investigating these interactions typically employs co-immunoprecipitation, bacterial two-hybrid systems, or structural biology approaches such as cryo-electron microscopy.

Understanding these interaction networks is essential for comprehending the complete mechanism of cobalt transport and its regulation in Pelobacter propionicus and related bacterial species .

How does post-translational modification affect the function of recombinant cbim1?

While the native cbim1 protein may undergo various post-translational modifications (PTMs) in Pelobacter propionicus, recombinant cbim1 expressed in E. coli systems typically lacks many of these modifications due to differences in cellular machinery. This discrepancy can significantly impact protein function and experimental outcomes.

Potential PTMs that may affect cbim1 function include:

Post-translational ModificationPotential Effect on Function
PhosphorylationMay regulate transport activity and protein-protein interactions
GlycosylationRare in bacterial proteins but could affect stability if present
Lipid modificationMay enhance membrane association and orientation
Disulfide bond formationCould stabilize tertiary structure and metal-binding capacity

Research comparing native and recombinant forms suggests that the absence of specific PTMs in recombinant cbim1 may result in altered cobalt binding affinity or transport kinetics. For studies requiring native-like function, expression systems that can perform relevant PTMs should be considered. Alternatively, in vitro modification approaches may be employed to introduce specific PTMs to the recombinant protein .

What are the optimal conditions for expressing recombinant cbim1 in E. coli systems?

Optimizing expression of recombinant cbim1 in E. coli requires careful consideration of several parameters to maximize yield while maintaining proper protein folding and function. The following protocol has been established as effective for cbim1 expression:

  • Expression vector selection: pET series vectors with T7 promoter provide strong, inducible expression

  • E. coli strain: BL21(DE3) or Rosetta(DE3) for enhanced expression of membrane proteins

  • Culture conditions:

    • Media: LB supplemented with 0.5% glucose and appropriate antibiotics

    • Temperature: Initial growth at 37°C until OD600 reaches 0.6-0.8

    • Induction: IPTG at 0.5 mM final concentration

    • Post-induction: Temperature reduction to 18-20°C for 16-18 hours

  • Cell harvest and lysis:

    • Centrifugation at 5000×g for 15 minutes at 4°C

    • Resuspension in lysis buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% DDM (n-Dodecyl β-D-maltoside), and protease inhibitors

    • Sonication or pressure-based lysis followed by centrifugation at 20,000×g for 30 minutes

This protocol typically yields 2-5 mg of purified protein per liter of culture. Modifications may be necessary based on specific research requirements and equipment availability .

What purification strategies are most effective for obtaining high-purity recombinant cbim1?

Purification of His-tagged recombinant cbim1 can be achieved through a multi-step process optimized for membrane proteins:

Step 1: Immobilized Metal Affinity Chromatography (IMAC)

  • Resin: Ni-NTA or TALON

  • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% DDM, 10 mM imidazole

  • Wash buffer: Same as binding buffer with 20-30 mM imidazole

  • Elution buffer: Same as binding buffer with 250-300 mM imidazole

  • Flow rate: 0.5-1 mL/min for optimal binding

Step 2: Size Exclusion Chromatography (SEC)

  • Column: Superdex 200 or equivalent

  • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM

  • Flow rate: 0.3-0.5 mL/min

Step 3: Ion Exchange Chromatography (Optional)

  • For samples requiring additional purification

  • Column: Q Sepharose for anion exchange

  • Buffer A: 20 mM Tris-HCl pH 8.0, 0.05% DDM

  • Buffer B: Same as Buffer A with 1 M NaCl

  • Gradient: 0-50% Buffer B over 20 column volumes

Final purity can be assessed by SDS-PAGE (expected >90% purity) and Western blotting using anti-His antibodies. Typical yield from this purification protocol is 1-3 mg of pure protein per liter of bacterial culture. The purified protein should be immediately used for experiments or stored as described in the storage recommendations .

What analytical methods are recommended for characterizing the structural integrity of purified cbim1?

Multiple analytical techniques should be employed to comprehensively assess the structural integrity and functional status of purified recombinant cbim1:

Biophysical Characterization:

  • Circular Dichroism (CD) Spectroscopy

    • Far-UV (190-260 nm): Secondary structure assessment

    • Near-UV (250-320 nm): Tertiary structure fingerprinting

    • Expected results: Primarily α-helical content with characteristic minima at 208 nm and 222 nm

  • Differential Scanning Calorimetry (DSC)

    • Temperature range: 20-90°C

    • Scan rate: 1°C/min

    • Buffer: 20 mM phosphate, pH 7.4

    • Parameter to determine: Thermal transition midpoint (Tm)

  • Dynamic Light Scattering (DLS)

    • Concentration range: 0.5-1 mg/mL

    • Expected hydrodynamic radius: 3-5 nm (monomer)

Functional Characterization:

  • Metal Binding Assay

    • Isothermal Titration Calorimetry (ITC) with CoCl2

    • Expected binding affinity (Kd): 0.1-10 μM range

    • Stoichiometry: Typically 1:1 protein:cobalt ratio

  • Reconstitution into Liposomes

    • Lipid composition: POPC:POPE (7:3)

    • Protein:lipid ratio: 1:100 to 1:1000 (w/w)

    • Transport assay using radioactive 57Co or fluorescent cobalt indicators

These analytical approaches provide complementary information about protein structure, stability, and function. Discrepancies between expected and observed results may indicate misfolding, aggregation, or loss of functional integrity during expression or purification processes .

How can I design experiments to study the role of specific amino acid residues in cobalt binding by cbim1?

Investigating the functional significance of specific amino acid residues in cbim1 requires a systematic approach combining site-directed mutagenesis with functional assays:

Experimental Design Strategy:

  • In silico analysis

    • Use homology modeling based on related transporters

    • Perform sequence alignment with other CbiM proteins

    • Identify conserved residues in metal-binding regions

    • Prioritize histidine, cysteine, aspartate, and glutamate residues for mutation

  • Site-directed mutagenesis

    • Generate single amino acid substitutions (typically to alanine)

    • Focus on residues in predicted transmembrane domains and metal-binding sites

    • Create a library of mutants expressing the following substitutions:

      • Conservative substitutions (maintaining charge/polarity)

      • Non-conservative substitutions (altering charge/polarity)

      • Deletion mutants for critical regions

  • Expression and purification

    • Express wild-type and mutant proteins under identical conditions

    • Purify using standard protocols (IMAC followed by SEC)

    • Verify protein integrity by SDS-PAGE and Western blotting

  • Functional characterization

    • Metal binding assays:

      • ITC to determine binding affinity constants (Kd)

      • Fluorescence spectroscopy with metal-sensitive probes

    • Transport assays:

      • Proteoliposome-based cobalt uptake assays

      • Whole-cell cobalt accumulation measurements

  • Structural analysis

    • CD spectroscopy to confirm proper folding

    • Limited proteolysis to assess conformational changes

    • X-ray crystallography or cryo-EM for selected mutants

Analysis should focus on correlating changes in metal binding or transport activity with specific amino acid substitutions. This approach can identify critical residues involved in cobalt coordination, conformational changes during transport, or protein-protein interactions within the transporter complex .

What approaches can be used to investigate the interaction between cbim1 and other components of the cobalt transport system?

Investigating protein-protein interactions within the cobalt transport system requires multiple complementary approaches:

Genetic Approaches:

  • Bacterial two-hybrid system

    • Construct fusions of cbim1 and potential partners to split reporter proteins

    • Screen for interactions based on reporter activation

    • Quantify interaction strength through reporter activity levels

  • Co-expression studies

    • Create operons expressing multiple components of the transport system

    • Assess functional complementation in transport-deficient strains

    • Measure transport activity as a readout of successful complex formation

Biochemical Approaches:

  • Co-immunoprecipitation (Co-IP)

    • Express epitope-tagged versions of cbim1 and partner proteins

    • Use antibodies against tags to pull down protein complexes

    • Identify interacting partners by Western blotting or mass spectrometry

  • Cross-linking coupled with mass spectrometry

    • Use chemical cross-linkers of varying lengths to stabilize transient interactions

    • Digest cross-linked complexes and analyze by LC-MS/MS

    • Identify cross-linked peptides to map interaction interfaces

Cross-linking AgentSpacer LengthReactive GroupsApplication
DSS11.4 ÅAmine-amineGeneral protein-protein interactions
EDC0 ÅCarboxyl-amineDirect contact sites
SMCC8.3 ÅAmine-sulfhydrylCysteine-specific interactions
  • Surface Plasmon Resonance (SPR)

    • Immobilize purified cbim1 on a sensor chip

    • Flow potential interacting partners over the surface

    • Measure binding kinetics and affinity constants

Structural Approaches:

  • Cryo-electron microscopy

    • Purify intact transport complexes in detergent micelles or nanodiscs

    • Determine structure at near-atomic resolution

    • Map interaction interfaces at the molecular level

  • X-ray crystallography of subcomplexes

    • Co-purify and crystallize cbim1 with individual partners

    • Determine structures of binary complexes

    • Build composite models of the full transport complex

These approaches provide complementary information about the composition, stoichiometry, and structural arrangement of the cobalt transport complex. Integration of data from multiple methods yields the most comprehensive understanding of the system .

How can I address poor solubility and aggregation issues when working with recombinant cbim1?

As a membrane protein, cbim1 presents significant challenges related to solubility and aggregation. These issues can be addressed through systematic optimization of expression and purification conditions:

Preventive Strategies:

  • Expression optimization

    • Reduce expression temperature to 16-18°C

    • Decrease inducer concentration (0.1-0.2 mM IPTG)

    • Use specialized E. coli strains (C41/C43) designed for membrane proteins

    • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Lysis and extraction conditions

    • Screen different detergents for optimal extraction:

    DetergentCritical Micelle ConcentrationSuitability for cbim1
    DDM0.17 mMExcellent primary choice
    LMNG0.01 mMGood for long-term stability
    CHAPS8-10 mMMild, may give lower yield
    SDS8.2 mMHarsh, may denature protein
    • Include stabilizing additives:

      • Glycerol (10-20%)

      • Specific lipids (0.01-0.1 mg/mL)

      • Low concentrations of cobalt (10-50 μM CoCl2)

  • Buffer optimization

    • Screen pH range (7.0-8.5)

    • Test various salt concentrations (100-500 mM NaCl)

    • Add osmolytes (trehalose, sucrose) at 5-10%

Remedial Approaches:

  • Aggregation removal

    • Centrifugation at 100,000×g for 30 minutes before chromatography

    • Filtration through 0.22 μm membrane

    • Addition of non-ionic detergents at concentrations slightly above CMC

  • Refolding strategies

    • Solubilize inclusion bodies in 8M urea or 6M guanidine HCl

    • Perform stepwise dialysis with decreasing denaturant and increasing detergent

    • Monitor refolding by CD spectroscopy

  • Alternative solubilization platforms

    • Reconstitution into nanodiscs using MSP1D1 scaffold protein

    • Incorporation into amphipols (A8-35)

    • Solubilization using SMALPs (styrene-maleic acid lipid particles)

By systematically addressing these variables, researchers can significantly improve the solubility and homogeneity of recombinant cbim1 preparations. Success can be monitored by analytical SEC, DLS, and negative-stain electron microscopy to assess monodispersity .

What are the common pitfalls in interpreting functional assays for cbim1 and how can they be addressed?

Functional characterization of cbim1 presents several challenges that can lead to misinterpretation of experimental results. Understanding these pitfalls and implementing appropriate controls is essential:

Challenge 1: Distinguishing Specific from Non-specific Metal Binding

Pitfall: Many divalent metal-binding assays lack specificity, leading to false positive results.
Solution:

  • Perform comparative binding studies with multiple divalent metals (Co2+, Ni2+, Zn2+, Fe2+)

  • Include negative controls using denatured protein or non-relevant membrane proteins

  • Use competition assays where unlabeled metals compete with labeled cobalt

  • Employ isothermal titration calorimetry (ITC) to obtain thermodynamic parameters specific to cobalt binding

Challenge 2: Reconstitution Efficiency Variability

Pitfall: Variable incorporation of protein into liposomes affects transport assay results.
Solution:

  • Quantify protein incorporation by SDS-PAGE analysis of reconstituted proteoliposomes

  • Normalize transport data to actual protein content rather than initial protein amount

  • Use fluorescent labeling to determine protein orientation in liposomes

  • Include internal standards to account for batch-to-batch variation

Challenge 3: Distinguishing Transport from Binding

Pitfall: Apparent cobalt uptake may represent binding to the protein rather than transport across the membrane.
Solution:

  • Include ionophores as controls to distinguish binding from transport

  • Perform assays at multiple temperatures (4°C vs. 37°C) to differentiate between the two processes

  • Use membrane-impermeable chelators to scavenge external cobalt

  • Monitor time-dependent kinetics that are characteristic of transport

Challenge 4: Cooperative Effects in Multi-component Systems

Pitfall: Studying cbim1 in isolation may not reflect its behavior in the complete transport complex.
Solution:

  • Compare activity of cbim1 alone versus reconstituted with partner proteins

  • Establish minimal functional units by systematic reconstitution of components

  • Use crosslinking to capture transient interaction states during transport

  • Develop coupled assays that monitor ATP hydrolysis and cobalt transport simultaneously

By addressing these challenges with appropriate experimental design and controls, researchers can obtain more reliable and interpretable data regarding the functional properties of cbim1 in cobalt transport .

How can recombinant cbim1 be applied in structural biology studies?

Recombinant cbim1 presents valuable opportunities for structural biology investigations that can elucidate the molecular mechanisms of cobalt transport. Several approaches are particularly promising:

X-ray Crystallography

  • Crystallization optimization

    • Detergent screening (vapor diffusion method):

      • Maltoside series (DDM, DM, NM)

      • Glucoside series (OG, NG)

      • Facial amphiphiles (facial maltoside derivatives)

    • Lipidic cubic phase (LCP) crystallization:

      • Monoolein or monopalmitolein as host lipids

      • Supplementation with specific lipids (POPE, POPG)

    • Crystal stabilization with cobalt or substrate analogs

  • Construct optimization

    • Create thermostabilized variants through systematic mutagenesis

    • Remove flexible regions that may impede crystal formation

    • Engineer fusion proteins with crystallization chaperones (T4 lysozyme, BRIL)

Cryo-Electron Microscopy

  • Sample preparation strategies

    • Reconstitution into nanodiscs with MSP1D1 or MSP1E3D1

    • Incorporation into amphipols (A8-35) or SMALPs

    • Formation of antibody complexes to increase particle size

  • Data collection parameters

    • Use of Volta phase plate for small membrane proteins

    • Optimal defocus range for 150-200 kDa complexes: -0.8 to -2.0 μm

    • Consideration of tilted data collection to address preferred orientation

Integrative Structural Biology

Combining multiple approaches for comprehensive structural characterization:

  • Small-angle X-ray scattering (SAXS) for solution structure

  • NMR spectroscopy for dynamic regions and ligand binding

  • Electron paramagnetic resonance (EPR) spectroscopy for conformational changes

  • Molecular dynamics simulations based on experimental structures

  • Cross-linking mass spectrometry for validating structural models

The integration of these methods can provide unprecedented insights into the structure-function relationships of cbim1, particularly in the context of the complete cobalt transport system. Such structural information forms the foundation for understanding substrate specificity, transport mechanisms, and potential applications in synthetic biology .

What are the emerging research directions for understanding the regulation of cbim1 in cobalt transport systems?

Several cutting-edge research directions are emerging in the study of cbim1 regulation and function:

Systems Biology Approaches

  • Transcriptional regulation networks:

    • Characterization of promoter elements controlling cbim1 expression

    • Identification of transcription factors responding to metal availability

    • Single-cell analysis of expression variability in microbial populations

  • Integration with metabolic networks:

    • Connections between cobalt transport and vitamin B12 biosynthesis

    • Metabolic flux analysis under varying cobalt availability

    • Computational modeling of cobalt-dependent metabolic pathways

Advanced Imaging Techniques

  • Super-resolution microscopy:

    • Localization and clustering of cbim1 in bacterial membranes

    • Dynamics of transporter assembly and disassembly

    • Colocalization with other transport and metabolic components

  • Single-molecule techniques:

    • FRET-based studies of conformational changes during transport

    • Optical tweezers to measure forces involved in substrate translocation

    • High-speed AFM to visualize transporter dynamics in membranes

Synthetic Biology Applications

  • Engineered transport systems:

    • Design of cbim1 variants with altered metal specificity

    • Creation of synthetic operons with tunable expression properties

    • Development of cobalt-dependent biosensors using modified cbim1

  • Biotechnological applications:

    • Engineered microorganisms for enhanced cobalt bioaccumulation

    • Bioremediation strategies for cobalt-contaminated environments

    • Microbial production of cobalt-dependent enzymes and vitamins

Evolutionary Perspectives

  • Comparative genomics:

    • Analysis of cbim1 homologs across bacterial phyla

    • Identification of adaptive mutations in metal-binding domains

    • Reconstruction of evolutionary trajectories of cobalt transport systems

  • Experimental evolution:

    • Selection for altered cobalt transport properties under laboratory conditions

    • Characterization of mutations arising under cobalt limitation or excess

    • Assessment of fitness effects associated with cbim1 variations

These emerging research directions promise to provide a comprehensive understanding of cbim1 function beyond the current molecular and structural perspectives, integrating it into broader cellular and ecological contexts. Such knowledge will have implications not only for fundamental microbiology but also for applications in biotechnology and biomedicine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.