Recombinant Pelobacter propionicus Cobalt transport protein CbiM 2 (cbiM2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalt Transport

CbiM 2 functions as a substrate-capture component of an ECF transporter, enabling cobalt acquisition at trace concentrations . Key mechanistic insights:

  • Substrate Specificity: Binds Co²⁺ with high affinity, critical for cobalt-dependent enzymes like coenzyme B₁₂ synthases .

  • Regulatory Elements: Likely regulated by a B₁₂ riboswitch upstream of its operon, as observed in homologous systems (e.g., Sinorhizobium meliloti) .

  • Transport Mechanism: Operates alongside ATP-binding (CbiO) and transmembrane (CbiQ) subunits in a modular ABC transporter system .

Production and Purification

Recombinant CbiM 2 is produced in multiple expression platforms:

Expression SystemAdvantagesCitations
E. coliCost-effective, high yield (≥1 mg/mL)
YeastPost-translational modifications, solubility
BaculovirusEukaryotic folding for functional assays

Purification employs affinity chromatography (His-tag), followed by buffer exchange into glycerol-containing storage solutions to prevent aggregation .

Research Applications

  • Metal Homeostasis Studies: Used to dissect cobalt uptake kinetics in Pelobacter propionicus and related syntrophic bacteria .

  • Enzyme Cofactor Research: Facilitates investigations into cobalt-dependent processes, including methanogenesis and nitrogen fixation .

  • Structural Biology: Serves as a template for crystallography or cryo-EM studies of ECF transporters .

Comparative Analysis with Homologs

CbiM 2 shares 78% sequence identity with Salmonella enterica CbiM, but differs in regulatory elements:

FeatureCbiM 2 (P. propionicus)CbiM (S. enterica)
Gene LocusPpro_1241STM3781
RiboswitchPutative B₁₂ element Confirmed B₁₂ riboswitch
Expression ControlCobalt-dependent repression B₁₂-mediated translational arrest

Stability and Handling

  • Reconstitution: Requires dilution to 0.1–1.0 mg/mL in sterile water, with 5–50% glycerol for long-term storage .

  • Activity Loss: Repeated freeze-thaw cycles reduce functionality; working aliquots stored at 4°C retain activity for ≤1 week .

Research Gaps and Future Directions

  • In Vivo Validation: Most data derive from heterologous expression in E. coli; native function in P. propionicus remains uncharacterized .

  • Regulatory Mechanisms: The putative B₁₂ riboswitch upstream of cbiM2 requires experimental validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
cbiM2; Ppro_1241; Cobalt transport protein CbiM 2; Energy-coupling factor transporter probable substrate-capture protein CbiM 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Target Names
cbiM2
Target Protein Sequence
MHIMEGFLPVEHAIGWSVASAPVVAYGLYSINKKIKKNPEQRMLLGVAAAFTFVLSALKM PSVTGSCSHPTGTGLGAILFGPSAVAPIGAVVLLFQALLLAHGGLTTLGANIFSMAIVGP FAAAAVFRLARAARFPFGVGVFLAASLGDLLTYVTTACQLAFAFPDPVGGFTASLAKFAG VFALTQIPLAISEGLLTVVVMNALLRFNREELGSLNIEGNGQEVQA
Uniprot No.

Target Background

Function
This protein is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ, which is involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pelobacter propionicus Cobalt transport protein CbiM 2?

Pelobacter propionicus Cobalt transport protein CbiM 2 (cbiM2) is a membrane protein involved in cobalt transport mechanisms. It belongs to the family of energy-coupling factor (ECF) transporters, specifically serving as a substrate-capture protein. The protein plays a critical role in facilitating cobalt uptake in P. propionicus, which is essential for various metabolic processes, particularly in the biosynthesis of vitamin B12 (cobalamin) . The protein is part of a larger system that enables P. propionicus to acquire necessary metal cofactors for its anaerobic metabolism.

What is the taxonomic classification of Pelobacter propionicus?

Pelobacter propionicus belongs to the genus Pelobacter, which consists of strictly anaerobic, Gram-negative, non-spore-forming, rod-shaped bacteria. These organisms utilize a very limited substrate range and are notably unable to ferment sugars, distinguishing them from other members of the Bacteroidaceae family . P. propionicus specifically differs from other Pelobacter species by producing propionate as one of its main fermentation products. The organism is named for its propionate-producing capabilities during the degradation of substrates such as acetoin, 2,3-butanediol, and ethanol .

What are the structural characteristics of CbiM proteins?

CbiM proteins, including the CbiM 2 from P. propionicus, are typically membrane-integrated proteins with multiple transmembrane domains. Based on data from related CbiM proteins, these proteins often form part of a complex with other components of the cobalt transport system. For instance, in Desulfovibrio vulgaris, a related deltaproteobacterium, the CbiK protein (which is functionally related to the cobalt transport system) has been found to form a tetramer and contains a heme b cofactor with a stoichiometry of one heme b per dimer . The structural features of CbiM proteins are optimized for metal ion coordination and transport across cell membranes.

What is the physiological role of cobalt transport in bacterial cells?

Cobalt transport proteins like CbiM 2 are physiologically crucial for bacterial survival as they facilitate the uptake of cobalt, an essential micronutrient. In bacteria such as P. propionicus, cobalt is primarily required as a central ion in vitamin B12 (cobalamin), which serves as a cofactor for various enzymes involved in:

  • Methyl group transfers

  • Rearrangement reactions

  • Reductive dehalogenation

  • Ribonucleotide reduction

The cobalt transport system ensures adequate intracellular cobalt concentrations to support these vital metabolic processes under varying environmental conditions . Without functional cobalt transport, bacteria would be unable to synthesize complete vitamin B12, leading to metabolic deficiencies.

What expression systems are recommended for recombinant production of P. propionicus CbiM 2?

For the recombinant production of P. propionicus CbiM 2, E. coli-based expression systems are most commonly employed due to their efficiency and well-established protocols. Based on related protein expression methods, the following approach is recommended:

  • Use of E. coli BL21(DE3) or equivalent strain with T7 RNA polymerase system

  • Construction of an expression vector containing the cbiM2 gene with an N-terminal histidine tag for purification

  • Optimization of expression conditions including temperature (typically 18-25°C), IPTG concentration (0.1-1.0 mM), and induction time (4-16 hours)

This approach has proven successful for related membrane proteins, including the CbiM protein from Methanocorpusculum labreanum, which was expressed as a full-length protein (1-231 amino acids) with an N-terminal His-tag in E. coli .

What are the optimal buffer conditions for maintaining CbiM 2 stability during purification?

The stability of membrane proteins like CbiM 2 during purification requires careful buffer optimization. Based on protocols for similar proteins, the following buffer conditions are recommended:

Buffer ComponentConcentrationPurpose
Tris/PBS20-50 mM (pH 8.0)Maintains physiological pH
NaCl150-300 mMProvides ionic strength
Glycerol5-10%Prevents aggregation
Mild detergent (DDM or LDAO)0.03-0.1%Solubilizes membrane protein
Protease inhibitorsAs recommendedPrevents degradation
DTT or β-mercaptoethanol1-5 mMMaintains reduced cysteines

For long-term storage, adding 6% trehalose and storing at -20°C/-80°C has shown effectiveness for similar proteins . Aliquoting is necessary to avoid repeated freeze-thaw cycles which can compromise protein integrity and function.

How can researchers verify the proper folding and activity of purified recombinant CbiM 2?

Verification of proper folding and activity of purified recombinant CbiM 2 requires multiple analytical approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure elements

    • Size exclusion chromatography to confirm proper oligomerization state

    • Thermal shift assays to determine protein stability

  • Functional analysis:

    • Cobalt binding assays using isothermal titration calorimetry (ITC)

    • Transport activity reconstitution in liposomes with fluorescent cobalt indicators

    • Complementation assays in cobalt transport-deficient bacterial strains

  • Interaction studies:

    • Pull-down assays to verify interactions with other components of the cobalt transport system

    • Surface plasmon resonance to measure binding kinetics with potential partner proteins

These methodological approaches provide comprehensive validation of properly folded and functional recombinant CbiM 2 protein.

What experimental design is recommended for studying cobalt transport kinetics using recombinant CbiM 2?

For studying cobalt transport kinetics with recombinant CbiM 2, a reversal design experimental approach is highly recommended. This design allows for the establishment of clear causal relationships between CbiM 2 function and cobalt transport. The experimental phases should follow an A-B-A-B pattern:

  • Phase A1: Baseline measurement with liposomes lacking CbiM 2

  • Phase B1: Introduction of functional CbiM 2 into liposomes

  • Phase A2: Inhibition of CbiM 2 (using specific inhibitors or altering conditions)

  • Phase B2: Restoration of CbiM 2 function by removing inhibition

This reversal design provides three replications of treatment effects (A1 vs B1, B1 vs A2, A2 vs B2), which is ideal for demonstrating experimental control . The approach allows researchers to conclusively demonstrate that changes in cobalt transport are functionally related to CbiM 2 activity rather than experimental artifacts or confounding variables.

What methods can be used to study the interaction between CbiM 2 and other components of the cobalt transport system?

The study of interactions between CbiM 2 and other components of the cobalt transport system requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP):

    • Using antibodies against CbiM 2 to pull down interacting partners

    • Western blot analysis to identify specific components that co-precipitate

  • Bacterial two-hybrid system:

    • Fusion of potential interacting proteins with complementary fragments of a reporter protein

    • Screening for interactions in a bacterial host system

  • Crosslinking coupled with mass spectrometry:

    • Chemical crosslinking of protein complexes in their native environment

    • MS/MS analysis to identify interacting proteins and interaction sites

  • Surface plasmon resonance (SPR):

    • Immobilization of CbiM 2 on a sensor chip

    • Real-time measurement of association and dissociation with potential partners

  • Förster resonance energy transfer (FRET):

    • Labeling CbiM 2 and potential partners with compatible fluorophores

    • Monitoring energy transfer as an indicator of protein-protein proximity

These methodologies provide complementary data that together can elucidate the complex interactions within the cobalt transport system.

How can researchers differentiate between cobalt and other metal ion transport by CbiM 2?

Differentiating between cobalt and other metal ion transport by CbiM 2 requires specific approaches to address the selectivity of the transport mechanism:

  • Competitive transport assays:

    • Use of radioactive or fluorescently labeled cobalt (⁵⁷Co or ⁶⁰Co)

    • Introduction of competing metal ions (Ni²⁺, Fe²⁺, Zn²⁺) at varying concentrations

    • Quantification of cobalt uptake inhibition by different metals

  • Isothermal titration calorimetry (ITC):

    • Direct measurement of binding thermodynamics

    • Determination of binding constants (Kd) for different metal ions

    • Comparison of enthalpic and entropic contributions to binding

  • Metal-specific fluorescent probes:

    • Use of metal-specific fluorescent indicators

    • Real-time monitoring of transport in reconstituted systems

    • Measurement of transport rates for different metal ions

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM with different bound metals

    • Identification of metal coordination sites and geometric preferences

    • Computational modeling of metal binding and transport pathway

Through these methods, researchers can establish the metal ion selectivity profile of CbiM 2 and identify the structural determinants of this selectivity.

How does the structure-function relationship in CbiM 2 compare to other cobalt transporters in prokaryotes?

The structure-function relationship of CbiM 2 in P. propionicus shows both similarities and distinct differences when compared to other prokaryotic cobalt transporters:

These comparative aspects provide insights into both the conserved mechanisms of cobalt transport and the specialized adaptations that have evolved in different prokaryotic lineages.

What is the relationship between CbiM 2 function and vitamin B12 biosynthesis in P. propionicus?

The relationship between CbiM 2 function and vitamin B12 biosynthesis in P. propionicus represents a critical metabolic nexus:

  • Cobalt supply regulation: CbiM 2 functions as a gatekeeper for cobalt entry, which is essential for the corrin ring of vitamin B12. The transport activity of CbiM 2 likely responds to cellular cobalt demands for cobalamin synthesis, with regulatory mechanisms that sense vitamin B12 pathway intermediates.

  • Integration with anaerobic B12 pathway: In anaerobic bacteria like P. propionicus, vitamin B12 synthesis follows the oxygen-independent pathway. Evidence from related deltaproteobacteria suggests that cobalt chelatases like CbiK are involved in inserting cobalt into sirohydrochlorin, forming cobalt-sirohydrochlorin, an early intermediate in the anaerobic vitamin B12 pathway .

  • Metabolic consequences: The efficiency of CbiM 2-mediated cobalt transport directly impacts the rate of vitamin B12 synthesis, which in turn affects numerous B12-dependent metabolic processes. In P. propionicus, which produces propionate as a major fermentation product, these B12-dependent pathways may be particularly important for energy conservation during anaerobic growth.

  • Co-regulation with vitamin B12 biosynthesis genes: Genomic analysis of related organisms indicates that CbiM encoding genes are often co-localized with other vitamin B12 biosynthesis genes or iron transport genes, suggesting coordinated expression and functional integration .

This relationship demonstrates how metal transport systems are intricately connected with specific biosynthetic pathways, highlighting the sophisticated metabolic coordination in prokaryotic cells.

How do mutations in key residues of CbiM 2 affect cobalt transport efficiency and selectivity?

The impact of mutations in key residues of CbiM 2 on cobalt transport reveals critical structure-function relationships:

Mutation TypePredicted LocationEffect on TransportEffect on SelectivityMechanism
Metal-coordinating residues (His, Cys, Asp, Glu)Transmembrane regionsSevere reduction or complete loss of transport activityMay alter preference between Co²⁺, Ni²⁺, and Fe²⁺Direct disruption of metal binding site geometry
Channel-lining residuesTransmembrane helicesModerate reduction in transport rateMinimal effect on selectivityAlteration of channel dimensions affecting metal passage
Conformational switch residuesInterface regionsReduced transport efficiencyVariable effects depending on specific residueDisruption of conformational changes required for transport cycle
Interface residuesContact sites with partner proteinsImpaired complex formationIndirect effects on selectivityDisruption of functional coupling with energy-providing components
Regulatory domain residuesCytoplasmic regionsAltered regulation of transportMinimal direct effect on selectivityInterference with allosteric regulation mechanisms

Systematic mutagenesis studies combined with functional assays would provide detailed insights into how specific residues contribute to the transport mechanism and metal selectivity of CbiM 2, potentially enabling rational engineering of transport properties for biotechnological applications.

What is the evolutionary relationship between CbiM 2 and other metal transporters in sulfate-reducing bacteria?

The evolutionary relationship between CbiM 2 and other metal transporters in sulfate-reducing bacteria reveals important insights into microbial adaptation and specialization:

  • Phylogenetic distribution: CbiM proteins are found across various prokaryotic groups, with notable representation in deltaproteobacteria including Desulfovibrio, Desulfobulbus, Desulfatibacillum, and Desulfobacterium species, as well as in archaeal species like Methanospirillum, Methanobrevibacter, and Synthrophobacter . This widespread distribution suggests ancient origins and essential functions.

  • Structural conservation vs. specialization: While core structural elements are conserved across CbiM homologs, significant differences exist in regulatory domains and partner protein interactions. In some Desulfovibrio species, CbiK proteins (functionally related to the cobalt transport system) contain unique heme b cofactors not found in other homologs, suggesting specialized adaptations .

  • Genomic context analysis: In many Desulfovibrio species, genes encoding CbiK proteins are located in operons with genes for iron transport proteins, permeases, and siderophore-related proteins, suggesting potential dual roles in both cobalt and iron metabolism . This genomic arrangement differs in P. propionicus, potentially reflecting its distinct metabolic requirements.

  • Functional divergence: While maintaining core metal transport functions, these proteins have diverged to optimize for particular metal ions, environmental conditions, and metabolic contexts. For instance, P. propionicus, which produces propionate as a main fermentation product , may have specific adaptations in its metal transport systems to support this distinctive metabolism.

This evolutionary analysis places CbiM 2 within a broader context of prokaryotic metal homeostasis systems, demonstrating how metal transporters have diversified to meet the specialized needs of different bacterial lifestyles.

What are common challenges in expressing and purifying functional CbiM 2 protein?

Researchers frequently encounter several challenges when working with membrane proteins like CbiM 2:

  • Low expression yields: Membrane proteins often express poorly in heterologous systems due to toxicity, improper folding, or aggregation. To address this:

    • Test multiple expression strains (C41(DE3), C43(DE3), or Lemo21(DE3))

    • Optimize growth temperature (typically lower temperatures of 18-25°C)

    • Use specialized media formulations with osmolytes

    • Consider fusion tags that enhance folding (MBP, SUMO)

  • Protein aggregation: Membrane proteins tend to aggregate when removed from their native membrane environment. Solutions include:

    • Careful screening of detergents (DDM, LDAO, FC-12)

    • Addition of stabilizing agents (glycerol, specific lipids)

    • Use of amphipols or nanodiscs for detergent-free purification

    • Maintaining low protein concentration during early purification steps

  • Loss of structural integrity: Maintaining the native structure throughout purification is critical. Strategies include:

    • Avoiding harsh conditions (extreme pH, high salt)

    • Incorporating relevant metal ions (cobalt) in purification buffers

    • Minimizing purification steps and handling time

    • Using rapid purification protocols at 4°C

  • Poor reconstitution: For functional studies, proper reconstitution into artificial membranes is essential. Recommended approaches:

    • Optimize lipid composition to mimic bacterial membranes

    • Control protein-to-lipid ratios carefully

    • Test multiple reconstitution methods (dialysis vs. direct incorporation)

    • Verify orientation in proteoliposomes using protease protection assays

Addressing these challenges requires systematic optimization and often a combination of approaches tailored to the specific properties of CbiM 2.

How can researchers address data inconsistencies in cobalt transport assays?

When confronted with data inconsistencies in cobalt transport assays, researchers should implement a systematic troubleshooting approach:

  • Standardize experimental conditions:

    • Establish rigorous protocols for liposome preparation (size, composition)

    • Control temperature precisely during assays (±0.5°C)

    • Use internal standards for all measurements

    • Employ single-case experimental designs with reversal phases to establish causality

  • Address technical variables:

    • Verify protein orientation in liposomes using protease protection assays

    • Test for liposome leakage using control fluorophores

    • Evaluate batch-to-batch variability in protein preparation

    • Quantify actual protein incorporation into liposomes

  • Control for interfering factors:

    • Screen for metal contamination in buffers and reagents

    • Test for interference from other cellular components

    • Use chelators to establish true baseline conditions

    • Consider the influence of counter-ion transport

  • Statistical approaches:

    • Implement robust statistical methods appropriate for time-series data

    • Use replicate measurements with appropriate controls

    • Consider Bayesian analysis for complex datasets

    • Apply segmented regression for identifying phase changes in transport kinetics

  • Data visualization:

    • Create clear graphical representations using data tables with appropriate formatting

    • Standardize graph formats for ease of comparison

    • Use visual systems that highlight experimental phases

    • Present raw data alongside processed results

By addressing these aspects methodically, researchers can identify sources of inconsistency and develop more reliable cobalt transport assays.

What considerations are important when designing in vitro vs. in vivo experiments for studying CbiM 2 function?

The design of experiments to study CbiM 2 function requires careful consideration of the strengths and limitations of both in vitro and in vivo approaches:

AspectIn Vitro ApproachesIn Vivo Approaches
System complexitySimplified systems allow focus on direct CbiM 2 functionComplex cellular environment provides physiological context
Control variablesHigh control over experimental parameters (pH, ion concentrations)Limited control but more biologically relevant conditions
Measurement precisionDirect quantitative measurements possibleOften reliant on indirect reporters or growth phenotypes
Time resolutionCan capture rapid transport events (milliseconds to seconds)Usually limited to longer timescales (minutes to hours)
Partner proteinsRequires explicit reconstitution of all componentsNative interaction partners present in correct stoichiometry
Regulatory elementsMust be deliberately incorporatedIntrinsic regulatory systems active
Experimental designWell-suited for reversal designs with clear phase changes Genetic complementation approaches often more appropriate
Data interpretationClearer mechanistic insights but questionable physiological relevanceMore physiologically relevant but complex to interpret mechanistically

An integrated approach combining both methodologies often provides the most comprehensive understanding:

  • Use in vitro systems to establish basic mechanism and kinetics

  • Validate findings in vivo to confirm physiological relevance

  • Return to in vitro approaches to investigate specific questions arising from in vivo observations

  • Develop mathematical models that bridge the gap between simplified in vitro systems and complex in vivo realities

This iterative strategy maximizes the strengths of each experimental paradigm while compensating for their respective limitations.

What emerging technologies could advance our understanding of CbiM 2 structure and function?

Several cutting-edge technologies are poised to revolutionize our understanding of CbiM 2:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution structures of membrane protein complexes

    • Visualization of different conformational states during transport cycle

    • Potential to capture CbiM 2 in complex with partner proteins

  • Single-molecule FRET (smFRET):

    • Real-time observation of conformational changes during transport

    • Determination of rate-limiting steps in the transport mechanism

    • Insights into the dynamics of metal binding and release

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping of protein dynamics and conformational changes

    • Identification of regions involved in protein-protein interactions

    • Detection of structural changes upon metal binding

  • Nanopore-based single-molecule sensing:

    • Direct electrical detection of individual transport events

    • High-resolution kinetic analysis of transport processes

    • Potential for high-throughput screening of inhibitors or modulators

  • Integrative computational approaches:

    • Molecular dynamics simulations of transport mechanisms

    • Machine learning for prediction of structure-function relationships

    • Systems biology modeling of metal homeostasis networks

These technologies, especially when used in combination, promise to provide unprecedented insights into the molecular mechanisms of CbiM 2-mediated cobalt transport.

How might understanding CbiM 2 contribute to broader research in bacterial metal homeostasis?

Research on CbiM 2 has significant implications for our understanding of bacterial metal homeostasis:

  • Unifying principles of metal selectivity:

    • Comparison of CbiM 2 with other metal transporters may reveal common structural motifs that determine metal specificity

    • Insights from CbiM 2 could inform design principles for engineering metal transport proteins with novel specificities

    • Establishment of structure-function relationships applicable across diverse bacterial transport systems

  • Metal homeostasis networks:

    • Understanding how CbiM 2 integrates into broader cobalt homeostasis mechanisms

    • Elucidation of cross-talk between different metal transport systems

    • Development of predictive models for how bacteria maintain optimal metal concentrations

  • Evolution of metal utilization:

    • Analysis of CbiM 2 variants across different bacterial lineages can illuminate how metal transport systems evolved

    • Insights into adaptation to different environmental metal availabilities

    • Understanding of horizontal gene transfer patterns for metal transport genes

  • Microbial ecology implications:

    • Role of metal transport in defining ecological niches for bacteria like P. propionicus

    • Competitive advantages conferred by efficient cobalt acquisition systems

    • Implications for microbial community interactions in metal-limited environments

These broader contributions highlight how detailed studies of individual transport proteins like CbiM 2 can advance our understanding of fundamental principles in bacterial physiology and evolution.

What potential applications might arise from detailed knowledge of CbiM 2 structure and function?

Detailed understanding of CbiM 2 structure and function could enable numerous applications:

  • Antimicrobial development:

    • Design of inhibitors targeting essential metal transport systems

    • Development of novel antibiotics that exploit bacterial dependence on metals

    • Creation of metal-sequestering compounds that work synergistically with existing antibiotics

  • Bioremediation technologies:

    • Engineering bacteria with enhanced metal uptake for environmental cleanup

    • Development of whole-cell biosensors for detecting toxic metals

    • Creation of microorganisms capable of recovering valuable metals from waste

  • Biotechnological applications:

    • Engineering of bacteria for improved production of vitamin B12 and related compounds

    • Development of microbial factories for metal-dependent enzymes

    • Creation of cell-based systems for controlled metal release in various applications

  • Synthetic biology tools:

    • Design of metal-responsive genetic circuits

    • Development of tunable gene expression systems based on metal transport

    • Creation of cellular logic gates that respond to specific metal concentrations

  • Medical applications:

    • Understanding how gut microbiota compete for metals in the intestinal environment

    • Development of probiotics with optimized metal acquisition systems

    • Insights into metal-related aspects of host-pathogen interactions

These diverse applications demonstrate how fundamental research on bacterial metal transport proteins can lead to practical innovations across multiple fields.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.