Recombinant Pelobacter propionicus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pelobacter propionicus Large-conductance Mechanosensitive Channel (mscL)

The Recombinant Pelobacter propionicus Large-conductance mechanosensitive channel (mscL) is a protein of interest in microbiological research, particularly in the study of mechanosensitive channels. Mechanosensitive channels are crucial for maintaining cellular osmotic balance by allowing ions to flow out of the cell when it is subjected to mechanical stress, such as changes in osmotic pressure. These channels are essential for the survival of bacteria in varying environments.

Background on Pelobacter propionicus

Pelobacter propionicus is a strictly anaerobic bacterium belonging to the family Geobacteraceae. It is known for its ability to ferment various organic compounds, producing propionate as a major end product . The study of its genetic components, such as the mscL channel, provides insights into how these bacteria adapt to different environmental conditions.

Mechanosensitive Channels

Mechanosensitive channels are membrane proteins that open in response to mechanical stress, allowing ions to flow out of the cell to prevent lysis. The large-conductance mechanosensitive channel (mscL) is one of the most studied mechanosensitive channels, originally identified in Escherichia coli. It is known for its large conductance and its role in protecting bacteria from osmotic shock.

Recombinant Pelobacter propionicus mscL

The recombinant form of the Pelobacter propionicus mscL channel is produced through genetic engineering techniques, where the gene encoding the mscL protein is cloned and expressed in a suitable host organism. This allows for the purification and study of the channel's properties in a controlled environment.

Data Tables

PropertyDescription
ConductanceLarge conductance, allowing rapid ion efflux.
ActivationOpens in response to mechanical stress (e.g., osmotic shock).
FunctionProtects bacteria from lysis by releasing ions under osmotic stress.
ExpressionCan be recombinantly expressed in various host organisms for study.

References

  1. ELISA Recombinant Pelobacter propionicus Large-conductance mechanosensitive channel(mscL): This product is available for research purposes but lacks detailed scientific publications specifically on its properties and functions .

  2. Pelobacter propionicus: Known for its anaerobic metabolism and propionate production, this bacterium's genetic components, like the mscL channel, are of interest for understanding microbial adaptation .

  3. Mechanosensitive Channels: General studies on mscL channels highlight their role in bacterial survival under osmotic stress, providing a framework for understanding similar channels in other bacteria.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Ppro_1689; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Target Names
mscL
Target Protein Sequence
MLKEFKEFAIRGNVIDLAIGIIIGGAFGKIVDSLVKDVIMPPVGMIMGKMDFASLFLNLS GTEYATLAEAKKAGAATLNYGIFISTIVDFLIMAFVVFLMVKQINRMKKEAPAPVAASDS KDCPFCLSPIPLQATRCPHCTSNLK
Uniprot No.

Target Background

Function
A membrane channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.