Recombinant Pelobacter propionicus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Membrane Protein Insertase YidC

Membrane protein insertase YidC from Pelobacter propionicus plays an essential role in the insertion, proper folding, and complex formation of integral membrane proteins. This protein belongs to the OXA1/ALB3/YidC family, specifically the Type 1 subfamily, which is conserved across bacteria, mitochondria, and chloroplasts . YidC serves as a molecular facilitator that guides membrane proteins from an aqueous environment into the hydrophobic lipid bilayer.

The insertion of proteins into prokaryotic plasma membranes is catalyzed by two primary mechanisms: translocases and insertases. While the Sec translocase operates as a transmembrane channel that can open laterally to release hydrophobic segments into the lipid bilayer, YidC insertases utilize a different approach. They interact with substrate proteins at a groove-like structure forming an amphiphilic protein-lipid interface, enabling transmembrane segments to slide directly into the membrane .

YidC functions through two distinct yet complementary pathways. It can operate independently to insert certain membrane proteins directly into the lipid bilayer, and it also works cooperatively with the Sec translocase to facilitate the insertion of more complex membrane proteins . This dual functionality underscores the versatility and importance of YidC in cellular membrane biogenesis.

Primary Structure and Classification

The YidC protein from Pelobacter propionicus consists of 542 amino acids with a molecular mass of approximately 59.5 kDa . It belongs to the OXA1/ALB3/YidC family, specifically the Type 1 subfamily, which is characterized by specific structural elements that facilitate membrane protein insertion .

The complete amino acid sequence of Pelobacter propionicus YidC is as follows:

MEKRTLLAVILSITVFYVFSLLFAPEKKPVQPESTGQAVSAPVSAGQPVAGGVQPSASAPSLPATAQQQDVTVRTGLYTAVFCSRGGALKSLTLKNYREKNLPDAQAVVLGSDADPSALTFSTRASGFNLPEGAPFVADATAVTMAGGEKKQLVFTHNSGQGFTVRKIYTFSGDSYGIKLDTQVFNNMAVPLVGTVQQVMTYPGLVKAKDSRFETAGSYLFSDNSLESDKLKDVSSASKLYDKNLQWSGFADKYFLTAILSEGGSIASVELRKNGAGFLESTVSSPRITVTPGQSVTVVHRLFVGPKDIDILKAQGNSLEQSLDLGWFTVIAKPLLYTLKYFYRYVGNYGVAIIIITIILKALFFPLTHKSYKSMKDMQKIQPMMAALKEKYKDDREGMNKAVMELYRDHKVNPLGGCLPMLVQIPVFFALYKALMFSIELRHAPFYFWITDLSGPDNLFGQMLGLPFVIGPLPLLMGATMFIQQKMTPSTMDPMQAKMMLALPVVFTFMFLNFPSGLVLYWLLNNILTIGQQMYINKLVND

Role in Membrane Protein Insertion

Pelobacter propionicus YidC plays a crucial role in the insertion, folding, and assembly of integral membrane proteins. It is involved in integrating membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as some lipoproteins . The protein particularly aids in the folding of multispanning membrane proteins, ensuring they achieve their correct tertiary structure for proper function .

The recently published high-resolution structures of YidC have provided new mechanistic insights into how transmembrane proteins achieve the transition from an aqueous environment in the cytoplasm to the hydrophobic lipid bilayer environment of the membrane . Unlike the channel-based mechanism of the Sec translocase, YidC facilitates membrane protein insertion through an interface-based mechanism at the protein-lipid boundary.

Sec-Dependent and Sec-Independent Pathways

YidC operates through two primary functional pathways:

Table 2: YidC Functional Pathways

PathwaySubstrate CharacteristicsMechanism
Sec-IndependentSmall membrane proteins with fewer transmembrane segmentsDirect insertion into the membrane without requiring Sec translocase
Sec-DependentComplex membrane proteins with multiple transmembrane segmentsCooperation with Sec translocase for proper insertion, folding, and assembly

In the Sec-independent pathway, YidC directly interacts with substrate proteins, guiding their transmembrane segments into the lipid bilayer through its groove-like structure . This pathway is typically utilized for simpler membrane proteins with one or a few transmembrane segments.

In the Sec-dependent pathway, YidC works in concert with the Sec translocase to facilitate the insertion and folding of more complex membrane proteins. In this context, YidC receives transmembrane segments from the Sec channel and assists in their proper integration into the membrane .

Expression and Purification

Recombinant production of Pelobacter propionicus YidC has been instrumental in advancing our understanding of membrane protein insertion mechanisms. The recombinant protein is typically produced in bacterial expression systems, with careful optimization to ensure proper folding and membrane integration of this complex protein.

Commercial preparations of recombinant YidC are available for research purposes, typically supplied at concentrations of approximately 50 μg per vial. The protein is usually stored in Tris-based buffer with 50% glycerol to maintain stability, and long-term storage at -20°C or -80°C is recommended to preserve its functional integrity .

Table 3: Recombinant YidC Production Specifications

ParameterSpecification
Typical Quantity50 μg
Expression SystemBacterial systems
Purification TagsDetermined during production process
Storage BufferTris-based buffer, 50% glycerol
Recommended StorageShort-term: 4°C; Long-term: -20°C or -80°C
Molecular Weight59.5 kDa

Research Applications

Recombinant YidC has numerous applications in membrane protein research:

  1. Structural Studies: High-resolution structural analysis of YidC has provided crucial insights into the mechanisms of membrane protein insertion .

  2. Functional Assays: In vitro systems using recombinant YidC have been developed to study membrane protein insertion mechanisms and to characterize YidC-dependent substrates .

  3. Interaction Studies: Recombinant YidC has been used to identify and characterize interactions with other proteins involved in membrane protein biogenesis .

  4. Reconstitution Experiments: Purified recombinant YidC can be reconstituted into liposomes to study its function in a controlled membrane environment.

YibN-YidC Interaction

Recent research has identified YibN as a significant interactor of YidC with important implications for membrane protein insertion. Co-expression studies and in vitro assays have demonstrated that YibN enhances the production and membrane insertion of YidC substrates, including M13 procoat and Pf3 coat proteins .

In experimental systems, inverted membrane vesicles (INVs) enriched for YibN showed a 1.5-1.8-fold stimulation of insertion for substrates like Pf3 coat, M13 procoat H5, and F0c, compared to control INVs . This enhancement effect suggests that YibN serves as a facilitator or regulator of YidC function, potentially optimizing its membrane protein insertion activity.

YidD-YidC Association

The gene encoding YidD is located 2 base pairs upstream of the yidC gene, suggesting a functional relationship between these proteins . Studies have shown that YidD is expressed and localizes to the inner membrane, likely through an amphipathic helix .

While YidD is not essential for cell growth and viability, comparative studies between wild-type and ΔyidD cells have revealed that YidD inactivation affects the insertion and processing of YidC-dependent inner membrane proteins . Furthermore, in vitro cross-linking experiments have demonstrated that YidD is in proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon, suggesting a direct role for YidD in the insertion process .

Table 4: YidC Protein Interactions

Interacting PartnerFunctional RelationshipEvidence
YibNEnhances production and insertion of YidC substratesCo-expression studies, in vitro assays
YidDInvolved in insertion and processing of YidC-dependent proteinsCross-linking studies, genetic proximity
Sec TranslocaseCoordinates insertion of complex membrane proteinsIdentification of specific interacting residues

Interaction with Sec Translocase

The interaction between YidC and the Sec translocase is critical for the proper insertion of many membrane proteins. Specific residues in YidC have been identified that mediate this interaction, providing insight into how these two systems coordinate their activities . This cooperation ensures the efficient and accurate insertion of complex membrane proteins with multiple transmembrane segments.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
As a standard practice, all our proteins are shipped with normal blue ice packs. Should you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Ppro_3623; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-542
Protein Length
full length protein
Species
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Target Names
yidC
Target Protein Sequence
MEKRTLLAVILSITVFYVFSLLFAPEKKPVQPESTGQAVSAPVSAGQPVAGGVQPSASAP SLPATAQQQDVTVRTGLYTAVFCSRGGALKSLTLKNYREKNLPDAQAVVLGSDADPSALT FSTRASGFNLPEGAPFVADATAVTMAGGEKKQLVFTHNSGQGFTVRKIYTFSGDSYGIKL DTQVFNNMAVPLVGTVQQVMTYPGLVKAKDSRFETAGSYLFSDNSLESDKLKDVSSASKL YDKNLQWSGFADKYFLTAILSEGGSIASVELRKNGAGFLESTVSSPRITVTPGQSVTVVH RLFVGPKDIDILKAQGNSLEQSLDLGWFTVIAKPLLYTLKYFYRYVGNYGVAIIIITIIL KALFFPLTHKSYKSMKDMQKIQPMMAALKEKYKDDREGMNKAVMELYRDHKVNPLGGCLP MLVQIPVFFALYKALMFSIELRHAPFYFWITDLSGPDNLFGQMLGLPFVIGPLPLLMGAT MFIQQKMTPSTMDPMQAKMMLALPVVFTFMFLNFPSGLVLYWLLNNILTIGQQMYINKLV ND
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. It assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its principal function in bacterial cells?

YidC is an essential bacterial membrane insertase that functions in the folding and insertion of many membrane proteins during their biogenesis. It is a multispanning protein located in the inner (cytoplasmic) membrane of bacteria like Escherichia coli, where it binds substrates through hydrophobic interactions in a region called the "greasy slide" . The protein contains a distinctive arrangement of five conserved transmembrane domains and a helical hairpin between transmembrane segments 2 and 3 on the cytoplasmic membrane surface .

YidC operates via two primary mechanisms: (1) independently as a membrane protein insertase, and (2) in concert with the SecYEG translocase . During co-translational membrane protein insertion, YidC interacts with the ribosome at the tunnel exit, facilitating the integration of nascent membrane proteins at the YidC protein-lipid interface . This process is essential for the proper assembly of various membrane proteins including phage coat proteins and subunits of respiratory complexes.

How does the structure of YidC facilitate its insertase function?

The function of YidC is directly related to its structural features. Within the membrane, YidC forms a hydrophilic groove flanked by the "greasy slide," which is located in the center of the membrane . This architecture creates a specialized environment for substrate processing:

  • The hydrophobic "greasy slide" region engages with the transmembrane segments of substrate proteins through hydrophobic interactions.

  • The hydrophilic part of the substrate transiently localizes in the groove of YidC before being translocated into the periplasm .

  • A single copy of YidC can interact with the ribosome at the ribosomal tunnel exit, creating a protected environment for nascent membrane proteins to enter the lipid bilayer .

This structural arrangement allows YidC to facilitate membrane protein insertion while minimizing the energetic barriers associated with transferring hydrophilic segments across the hydrophobic membrane environment.

What experimental evidence supports the interaction of YidC with ribosomes during co-translational insertion?

Cryo-electron microscopy reconstructions have provided direct evidence for YidC-ribosome interactions during co-translational membrane protein insertion. Studies have visualized a translating YidC-ribosome complex carrying the YidC substrate F0c, demonstrating how a single copy of YidC interacts with the ribosome at the ribosomal tunnel exit . This structural data reveals a defined site for membrane protein insertion at the YidC protein-lipid interface.

Additional experimental approaches supporting this interaction include:

  • Evolutionary co-variation analysis to predict contacts between pairs of residues in YidC

  • Lipid-versus-protein-exposure studies to determine membrane topology

  • Molecular dynamics simulations to validate structural models

Together, these methods have elucidated the mechanism for co-translational YidC-mediated membrane protein insertion, showing how YidC creates a protected pathway from the ribosome directly into the membrane.

What are the recommended methods for identifying YidC interaction partners?

Several complementary approaches have proven effective for identifying YidC interaction partners:

  • Proximity-dependent biotin labeling (BioID): This technique involves fusing a mutant biotin ligase BirA* to YidC, allowing biotinylation of proteins in close proximity. After expression and membrane isolation, biotinylated proteins can be captured using NeutrAvidin beads and identified by LC-MS/MS . This approach revealed YibN as a significant YidC interactor.

  • Affinity pulldown with SILAC labeling: This method uses His-tagged YidC expressed in cells grown with isotope-labeled lysine (Lys4/Lys0). After membrane solubilization with detergent, YidC and its interaction partners are captured using Ni-NTA agarose beads and identified by LC-MS/MS . The isotope labeling allows quantitative comparison between experimental and control samples.

  • Native-gel electrophoresis with purified proteins: Purified YidC and potential interaction partners can be analyzed by blue-native PAGE to detect complex formation . This technique confirmed the YidC-YibN interaction, revealing a distinctive band when the proteins were incubated together.

  • SPA-tag affinity purification: Using strains with chromosomally encoded proteins tagged with SPA (sequential peptide affinity), native complexes can be isolated and analyzed . This approach validated the YidC-YibN interaction under native expression conditions.

These methods provide complementary evidence for protein interactions, from in vivo proximity to direct physical binding.

How can researchers assess the functional impact of YidC on membrane protein insertion?

To evaluate YidC's role in membrane protein insertion, researchers can employ several functional assays:

  • Co-expression studies: By co-expressing YidC (or interacting proteins like YibN) with known YidC substrates such as M13 procoat protein, Pf3 coat protein, or ATP synthase subunit c (F0c), researchers can monitor effects on substrate production and membrane insertion . Western blot analysis with substrate-specific antibodies allows quantification of these effects.

  • In vitro translation and insertion assays: Inverted membrane vesicles (INVs) enriched for YidC or its interacting partners can be used to assess membrane protein insertion in a cell-free system . This approach showed that INVs enriched for YibN supported a 1.5-1.8-fold stimulation of insertion for substrates like Pf3 coat, M13 procoat, and F0c .

  • Proteinase K protection assays: This technique identifies membrane-protected fragments (MPFs) after insertion and proteolytic digestion, allowing assessment of insertion efficiency and topology . For example, this method revealed that SecG generates three distinct MPFs after membrane insertion.

  • Membrane lipid analysis: Lipidomic approaches can reveal changes in membrane composition associated with YidC function or the activity of its interacting partners . YibN overproduction has been shown to stimulate membrane lipid production and promote inner membrane proliferation.

These methodologies provide comprehensive insights into both the quantity and quality of membrane protein insertion mediated by YidC and its partners.

What purification strategies are effective for recombinant YidC preparations?

Obtaining pure, functional YidC requires specialized approaches for membrane protein purification:

  • Detergent solubilization: YidC can be efficiently solubilized from membranes using mild detergents like n-dodecyl β-D-maltoside (DDM) . This preserves protein structure while extracting YidC from the lipid bilayer.

  • Affinity chromatography: His-tagged YidC can be purified to homogeneity using Ni-NTA agarose beads . Multiple washing steps with increasing imidazole concentrations help remove non-specifically bound proteins.

  • Size exclusion chromatography: This technique separates proteins based on size and can be used as a polishing step to achieve high purity while also providing information about the oligomeric state of YidC.

  • Detergent exchange: For structural studies or reconstitution experiments, it may be necessary to exchange the initial solubilization detergent for one more suitable to the intended application.

The purified protein can be validated by SDS-PAGE (to assess purity) and blue-native PAGE (to evaluate oligomeric state and complex formation) . Functional assays with model substrates should be performed to confirm that the purified YidC retains insertase activity.

How does YibN modulate YidC function and what are the implications for membrane protein biogenesis?

YibN has emerged as a significant interactor of YidC with profound effects on membrane protein biogenesis. Research has revealed:

  • Physical interaction: YibN forms a stable complex with YidC, depending critically on YibN's N-terminal transmembrane segment . This interaction was validated by multiple independent techniques including BioID, affinity pulldown, and native-gel electrophoresis .

  • Enhancement of substrate insertion: Co-expression of YibN significantly increases the production of various YidC substrates, including M13 procoat (PC-Lep), Pf3 coat protein (Pf3-23Lep), and ATP synthase subunit c (F0c) . In vitro assays with inverted membrane vesicles enriched for YibN showed a 1.5-1.8-fold stimulation of substrate insertion .

  • Membrane remodeling effects: YibN overproduction stimulates membrane lipid synthesis and promotes inner membrane proliferation, possibly by interfering with YidC lipid scramblase activity . Electron microscopy revealed membrane circumvolutions and multilayered structures at the inner membrane upon YibN overexpression .

  • Specificity of enhancement: While YibN enhances the biogenesis of several membrane proteins, including SecG, this effect is substrate-specific and depends on particular features of the substrate proteins .

The discovery of YibN as a YidC modulator suggests that the membrane insertion machinery has more regulatory complexity than previously appreciated. YibN's location in an operon with genes encoding GrxC (involved in disulfide bond reduction), SecB (maintaining proteins competent for secretion), and GpsA (glycerophospholipid synthesis) hints at coordinated regulation of protein and lipid biogenesis .

What is the potential of YidC as an antibiotic target and what binding sites could be exploited?

YidC represents a promising antibacterial target due to its essential role in bacterial membrane protein biogenesis. Key aspects of its potential include:

  • Essential function: YidC is required for cell viability, making it an attractive antibiotic target .

  • Structural features for drug binding: The hydrophilic groove of YidC, flanked by the greasy slide, provides a promising target for inhibitors that would block insertase function . This groove is located within the center of the membrane and is critical for substrate processing.

  • Substrate binding site: The greasy slide, which binds various substrates through hydrophobic interactions, could also provide a binding site for inhibitory molecules .

  • Mechanistic considerations: Inhibitors could potentially disrupt:

    • YidC's interaction with its substrates

    • The association between YidC and partner proteins like SecYEG or SRP

    • Conformational changes required for insertase activity

  • Selectivity potential: Despite conservation across species, structural differences between bacterial YidC and its eukaryotic homologs (Oxa1 in mitochondria and Alb3 in chloroplasts) might allow for selective targeting of bacterial insertases .

Drug development strategies could focus on designing molecules that can access the membrane-embedded binding sites of YidC and specifically disrupt its insertase function, potentially leading to novel antibiotics with unique mechanisms of action against multidrug-resistant bacteria.

How do YidC-dependent and Sec-dependent membrane protein insertion pathways interact and regulate each other?

The interaction between YidC and the Sec machinery represents a sophisticated system for coordinating membrane protein insertion:

Understanding the interplay between these pathways is crucial for developing a comprehensive model of membrane protein biogenesis and potentially for designing interventions that could selectively disrupt specific insertion routes.

What are common challenges in YidC functional studies and how can they be addressed?

Researchers studying YidC function often encounter several technical challenges:

By anticipating these challenges and implementing appropriate controls and alternative approaches, researchers can obtain more reliable and interpretable data from YidC functional studies.

How should researchers interpret contradictory findings about YidC substrate specificity?

Contradictory findings regarding YidC substrate specificity are common in the literature and require careful consideration:

  • Context-dependent effects: YidC requirements may vary based on experimental conditions.

    • Analysis approach: Document all experimental parameters, including growth conditions, strain backgrounds, and expression levels that might influence substrate processing .

    • Analysis approach: Test substrate dependence under multiple conditions to identify context-specific effects.

  • Redundant pathways: Some proteins may use multiple insertion pathways with different efficiencies.

    • Analysis approach: Quantify insertion efficiency rather than simply categorizing proteins as YidC-dependent or independent .

    • Analysis approach: Examine insertion in strains with combined deficiencies in multiple pathways to reveal redundancy.

  • Post-insertion effects: YidC may affect protein stability or folding after the initial insertion step.

    • Analysis approach: Distinguish between effects on insertion, folding, and stability through pulse-chase experiments and protease susceptibility assays .

    • Analysis approach: Examine membrane-protected fragments to determine if specific domains show differential YidC dependence .

  • Sensitivity of detection methods: Different methods have varying sensitivity for detecting partial insertion defects.

    • Analysis approach: Employ multiple complementary methods to assess insertion, including in vivo and in vitro approaches .

    • Analysis approach: Consider kinetic parameters, as YidC may affect insertion rates rather than absolute insertion capability.

Researchers should interpret contradictory findings as opportunities to discover nuanced aspects of YidC function rather than as experimental failures, as they may reveal regulatory complexity in membrane protein biogenesis.

What controls are essential for validating YidC-substrate interactions?

Proper controls are critical for establishing genuine YidC-substrate interactions:

Implementing these controls ensures that observed interactions represent genuine biological phenomena rather than experimental artifacts.

What are the unexplored aspects of YidC-YibN interactions that warrant further investigation?

Several aspects of YidC-YibN interactions remain to be fully characterized:

  • Structural basis of interaction: While the N-terminal transmembrane segment of YibN is known to be critical for YidC binding , the precise molecular details of this interaction remain to be elucidated. Cryo-EM or X-ray crystallography studies of the YidC-YibN complex would provide valuable insights.

  • Regulatory mechanisms: The observation that YibN is upregulated upon YidC or SecDF-YajC depletion suggests regulatory feedback mechanisms that remain poorly understood. Investigating the transcriptional and post-transcriptional regulation of YibN could reveal how cells coordinate membrane protein insertion pathways.

  • Role in membrane remodeling: YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation , but the mechanism behind this effect and its physiological significance requires further study. Detailed lipidomic analyses and membrane fluidity measurements could help clarify this aspect.

  • Species-specific differences: Current research has focused on E. coli YidC and YibN, but comparative studies in other bacterial species, including Pelobacter propionicus, would help identify conserved versus species-specific aspects of this interaction.

  • Potential role in stress responses: The location of YibN in an operon with genes involved in protein folding and lipid synthesis hints at a potential role in stress responses, which could be investigated through stress challenge experiments.

These research directions would contribute to a more comprehensive understanding of the YidC-YibN interplay and its role in bacterial membrane biology.

How might comparative studies of YidC from different bacterial species advance the field?

Comparative studies of YidC across bacterial species offer several potential advances:

  • Conservation analysis: Identifying the most highly conserved regions across diverse bacterial YidC proteins could pinpoint functionally critical domains. This information would be valuable for:

    • Understanding the core insertase mechanism

    • Designing broad-spectrum antibiotics targeting YidC

    • Predicting substrate specificity determinants

  • Adaptation to ecological niches: Different bacteria inhabit diverse environments with varying membrane compositions and stresses. Comparing YidC from organisms like Pelobacter propionicus (an anaerobe) with those from other bacteria could reveal adaptations in the insertase machinery to specific ecological demands.

  • Interaction network evolution: The discovery of YibN as a YidC partner in E. coli raises questions about the conservation of this and other interactions across species. Interaction profiling of YidC from multiple species could reveal how membrane protein insertion networks have evolved.

  • Species-specific insertase functions: Some bacteria may have evolved specialized YidC functions related to their specific membrane protein content or environmental adaptations. Identifying these specialized functions could provide insights into bacterial membrane biology.

  • Structure-function correlations: Solving structures of YidC from diverse bacteria, particularly species with distinctive membrane characteristics, would help connect structural variation to functional differences.

Such comparative approaches would provide a more nuanced understanding of YidC biology beyond the E. coli paradigm that currently dominates the field.

What technological innovations could enhance research on membrane protein insertases?

Several emerging technologies could significantly advance research on YidC and other membrane protein insertases:

  • Single-molecule techniques: Methods like single-molecule FRET could track conformational changes in YidC during substrate binding and insertion, providing dynamic insights that are difficult to obtain with ensemble measurements.

  • Cryo-electron tomography: This technique could visualize YidC in its native membrane environment, potentially revealing higher-order assemblies or interactions with other membrane components that may be lost during purification.

  • Advanced membrane mimetics: Novel membrane mimetics such as nanodiscs, SMALPs (styrene maleic acid lipid particles), or cell-derived membrane vesicles could provide more native-like environments for studying YidC function compared to detergent micelles.

  • High-throughput substrate profiling: Developing systematic approaches to identify the complete substrate repertoire of YidC, such as ribosome profiling combined with YidC depletion or proximity labeling of nascent chains near YidC, would provide a comprehensive view of YidC function.

  • Computational approaches: Molecular dynamics simulations incorporating increasing computational power and improved force fields could model the complex process of membrane protein insertion with greater accuracy, generating testable hypotheses about YidC mechanism.

  • Synthetic biology tools: Engineered YidC variants with novel properties or controllable activity could be powerful tools for dissecting insertase function and potentially for biotechnological applications requiring membrane protein production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.