Recombinant Pelobacter propionicus Protein CrcB homolog (crcB)

What is Recombinant Pelobacter propionicus Protein CrcB homolog (crcB)?

Recombinant Pelobacter propionicus Protein CrcB homolog (crcB) is a laboratory-produced version of a membrane protein naturally found in the bacterium Pelobacter propionicus strain DSM 2379. The protein belongs to the CrcB family, which is associated with camphor resistance in various bacterial species . The recombinant form is typically expressed in suitable host systems such as E. coli to enable detailed biochemical and structural studies. The UniProt accession number for this protein is A1AM94, with its sequence comprising 129 amino acids and forming a multi-pass membrane protein structure . The gene is specifically identified by the ordered locus name Ppro_0835, highlighting its position within the P. propionicus genome .

What are the key structural characteristics of CrcB homolog proteins?

CrcB homolog proteins, including the one from Pelobacter propionicus, share several important structural features. The protein is characterized by a hydrophobic profile consistent with its membrane-spanning nature, containing multiple transmembrane domains . The amino acid sequence of P. propionicus CrcB homolog (MKSALTIALFCAGGGLARYYLSGWVYGLLGRAFPFGTLAVNLIGAYCIGLIMEISLRSTLIPATLRLGLTVGFMGGLTTFSTFSYETFKLLEDGQYLVAMVNALASVVMCLLCTWLGVITARALIQGGF) reveals a pattern of hydrophobic residues interspersed with charged and polar amino acids, which is typical for membrane proteins . Comparative analysis with other CrcB homologs, such as the one from Bacteroides vulgatus (sequence: MKSLLLIFLGGGTGSVLRYLLTISIYRQGTTNFPWGTFAVNILGCILIGVFYTLTSRIHINNDIRLMLTIGLCGGFTTFSTFSNESLQLLKSGLYPSFFTYI​IGSVVLGILGVMLGIWMSE), shows conservation of key structural elements despite some sequence variations . These proteins typically form oligomeric complexes in the membrane, contributing to their functional properties as channels or transporters.

What is the optimal storage condition for Recombinant Pelobacter propionicus Protein CrcB homolog?

The optimal storage conditions for Recombinant Pelobacter propionicus Protein CrcB homolog are critical for maintaining protein stability and activity. According to product specifications, the protein should be stored at -20°C for regular storage, while -80°C is recommended for extended storage periods . The protein is typically provided in a stabilizing buffer containing Tris-based components and 50% glycerol, which helps prevent denaturation during freeze-thaw cycles . It is strongly advised to avoid repeated freezing and thawing of the protein, as this can lead to degradation and loss of activity . For working experiments, it is recommended to prepare small aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles . These storage recommendations are similar to those for other recombinant membrane proteins and reflect the general challenges of maintaining membrane protein stability in vitro.

How can I verify the purity and activity of Recombinant Pelobacter propionicus Protein CrcB homolog?

Verifying the purity and activity of Recombinant Pelobacter propionicus Protein CrcB homolog requires multiple complementary approaches:

• Purity Assessment:

  • SDS-PAGE analysis should be performed to confirm a single predominant band at approximately 14 kDa (the expected molecular weight) .

  • Western blotting using antibodies against the protein or any attached tags can provide further confirmation of identity.

  • For higher resolution analysis, mass spectrometry can verify the exact molecular weight and sequence coverage.

• Functional Activity:

  • While specific activity assays for CrcB homologs may not be standardized, approaches similar to those used for channel proteins can be adapted.

  • Fluoride ion binding or transport assays using fluorescent probes may be applicable given the proposed function of CrcB family proteins.

  • Reconstitution into liposomes followed by ion flux measurements can provide functional data .

• Structural Integrity:

  • Circular dichroism spectroscopy can confirm secondary structure content expected for a membrane protein.

  • Size-exclusion chromatography can verify the oligomeric state and homogeneity of the preparation.

The expected purity should be ≥85% as determined by SDS-PAGE according to typical recombinant protein standards . Documentation accompanying commercial preparations typically includes quality control reports that can serve as reference points for independent verification.

What expression systems are most effective for producing Recombinant Pelobacter propionicus Protein CrcB homolog?

The selection of an appropriate expression system for Recombinant Pelobacter propionicus Protein CrcB homolog requires careful consideration of multiple factors:

• Bacterial Expression Systems:

  • E. coli remains the most commonly used host for initial expression attempts due to its rapid growth, well-established genetic tools, and cost-effectiveness .

  • Specialized E. coli strains like C41(DE3) or C43(DE3), designed for membrane protein expression, may provide higher yields of correctly folded protein.

  • Expression conditions similar to those optimized for pneumolysin production (0.1 mM IPTG induction at OD600 of 0.8, followed by growth at 25°C for 4 hours) may serve as a starting point for optimization .

• Eukaryotic Expression Systems:

  • For more complex membrane proteins requiring specific post-translational modifications, yeast (Pichia pastoris or Saccharomyces cerevisiae) or baculovirus-insect cell systems may be preferable .

  • Mammalian cell expression systems, while more expensive, can provide native-like membrane environments for proper folding of complex membrane proteins .

• Cell-Free Expression Systems:

  • These systems can be advantageous for toxic membrane proteins, allowing direct incorporation into artificial membranes during synthesis.

The choice between these systems should be guided by the specific research goals, required protein yield, and the intended downstream applications. E. coli-based systems have been successfully used for many CrcB homologs, suggesting this as a reasonable first approach .

How can I optimize soluble expression of Recombinant Pelobacter propionicus Protein CrcB homolog?

Optimizing soluble expression of membrane proteins like Recombinant Pelobacter propionicus Protein CrcB homolog presents significant challenges that can be addressed through systematic experimental design approaches:

• Expression Parameter Optimization:

  • Following the experimental design methodology described for pneumolysin expression, key variables to consider include induction OD600 (optimal around 0.8), IPTG concentration (0.1 mM may be sufficient), temperature (25°C often favors proper folding over 37°C), and duration (4 hours may be optimal) .

  • A factorial design approach, testing multiple variables simultaneously, can efficiently identify optimal conditions as demonstrated in the pneumolysin study .

• Media Composition Adjustments:

  • Media composition significantly impacts membrane protein expression. A starting formulation might include 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose, similar to what worked for other recombinant proteins .

  • Addition of specific additives like glycerol (1-2%) or specific detergents at sub-CMC concentrations may improve membrane protein solubility.

• Fusion Tags and Solubility Enhancers:

  • N-terminal and/or C-terminal tags may be employed to enhance solubility, with the specific tag type selected based on protein-tag stability considerations .

  • Common solubility-enhancing tags include MBP (maltose-binding protein), SUMO, or Thioredoxin.

• Detergent Screening:

  • For membrane proteins, the choice of detergent for extraction and purification is critical.

  • A systematic screen of detergents (ranging from harsh ionic detergents to milder non-ionic options) should be performed to identify conditions that maintain the protein in a soluble, correctly folded state.

The highest reported yields for properly folded recombinant membrane proteins in E. coli systems typically range from 5-50 mg/L of culture, with exceptional cases reaching up to 250 mg/L as reported for other recombinant proteins .

What are the functional differences between CrcB homologs from different bacterial species?

Functional differences between CrcB homologs from different bacterial species represent an important area of comparative research:

• Sequence Variation and Functional Implications:

  • Comparison of Pelobacter propionicus CrcB homolog (129 amino acids) with Bacteroides vulgatus CrcB homolog (121 amino acids) reveals conservation in transmembrane regions but variation in connecting loops and termini .

  • These sequence differences likely translate to species-specific functional adaptations while maintaining the core channel or transporter activity.

• Substrate Specificity:

  • While the CrcB family is generally associated with camphor resistance, specific homologs may have evolved different ion selectivity or regulatory mechanisms.

  • Comparative functional assays using reconstituted proteins from different species can reveal differences in ion conductance, selectivity, or gating properties.

• Environmental Adaptations:

  • CrcB homologs from extremophiles versus mesophiles may show adaptations in stability, temperature optima, or pH dependence.

  • The P. propionicus CrcB homolog, coming from an anaerobic bacterium, may show functional characteristics adapted to low-oxygen environments compared to aerobic bacterial homologs.

• Structural Variations:

  • Differences in oligomerization state, transmembrane topology, or specific structural motifs can be correlated with functional differences through comparative structural biology approaches.

Understanding these functional differences can provide insights into the evolutionary adaptations of these proteins and may suggest novel applications in biotechnology or targeted approaches for antimicrobial development.

How can recombineering techniques be applied to study CrcB homolog function?

Recombineering (recombination-based genetic engineering) offers powerful approaches for studying CrcB homolog function through precise genetic manipulation:

• In vivo Mutagenesis:

  • Recombineering allows for precise introduction of point mutations, deletions, or insertions into the crcB gene without requiring restriction enzyme sites .

  • Single-stranded DNA oligonucleotides can be used to introduce specific mutations with high efficiency, enabling systematic structure-function studies .

• Domain Swapping and Chimeric Proteins:

  • Recombineering facilitates the creation of chimeric proteins where domains from different CrcB homologs are exchanged to identify regions responsible for specific functional properties .

  • This approach can be particularly valuable for mapping determinants of ion selectivity or regulatory domains.

• Reporter Fusions and Tagging:

  • Gene tags can be precisely inserted through recombineering to create reporter fusions that maintain the native context of the gene .

  • These constructs can enable live-cell visualization of protein localization or real-time activity monitoring.

• Chromosomal Manipulation:

  • Beyond plasmid-based expression, recombineering allows modification of the crcB gene in its native chromosomal context in model organisms .

  • This approach maintains native regulation and expression levels, avoiding artifacts associated with overexpression.

The primary advantage of recombineering for CrcB homolog studies is the ability to create precise genetic constructs within approximately one week, much faster than traditional cloning methods, enabling rapid testing of hypotheses about protein function .

What are the challenges in crystallizing membrane proteins like CrcB homologs?

Crystallizing membrane proteins like CrcB homologs presents numerous challenges that require specialized approaches:

• Detergent Selection and Protein Stability:

  • The choice of detergent is critical for extracting the protein from membranes while maintaining its native fold.

  • A systematic detergent screen is typically required, testing dozens of detergents and detergent combinations.

  • The protein's stability in different detergents must be assessed through methods like thermal shift assays or size-exclusion chromatography.

• Crystal Packing Limitations:

  • Membrane proteins have limited hydrophilic surfaces available for crystal contacts, making crystal formation difficult.

  • Approaches to overcome this include:

    • Use of antibody fragments (Fab or nanobodies) to increase the hydrophilic surface area

    • Creation of fusion proteins with crystallization chaperones

    • Lipidic cubic phase or bicelle crystallization methods that provide a membrane-like environment

• Conformational Heterogeneity:

  • Membrane proteins often exist in multiple conformational states, leading to heterogeneity that hinders crystallization.

  • Stabilizing specific conformations through ligands, inhibitors, or engineered disulfide bonds can improve crystallization prospects.

• Optimization Strategies:

  • High-throughput crystallization screening using specialized membrane protein screens

  • Systematic truncation of flexible regions that might hinder crystal packing

  • Controlling the lipid composition of the crystallization environment

The crystallization of membrane proteins typically requires larger quantities of highly pure protein compared to soluble proteins, often 10-50 mg for comprehensive crystallization trials, highlighting the importance of optimizing expression and purification protocols.

How should I design experiments to study CrcB homolog interactions with other proteins?

Designing experiments to study CrcB homolog interactions requires a multi-faceted approach that addresses the unique challenges of membrane protein interaction studies:

• In vitro Interaction Assays:

  • Pull-down assays: Using tagged versions of the CrcB homolog (maintaining the tag types determined during the production process) to identify binding partners .

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics, the CrcB homolog can be immobilized on a sensor chip through available tags, with potential interacting partners flowing over the surface.

  • Crosslinking followed by mass spectrometry: This approach can capture transient interactions and is particularly valuable for membrane protein complexes.

• In vivo Interaction Studies:

  • Bacterial two-hybrid systems: Adapted for membrane proteins, these can identify potential interacting partners in a cellular context.

  • Förster Resonance Energy Transfer (FRET): By tagging the CrcB homolog and potential partners with appropriate fluorophores, interactions can be monitored in real-time in living cells.

  • Co-immunoprecipitation from native membranes: This approach can identify physiologically relevant interactions.

• Experimental Controls and Validation:

  • Negative controls should include unrelated membrane proteins with similar topology.

  • Competitive binding assays can confirm specificity of observed interactions.

  • Multiple complementary methods should be used to validate key interactions.

  • Recombineering approaches can be employed to create point mutations that disrupt specific interactions for functional validation .

• Considerations for Membrane Protein Interactions:

  • The detergent environment must mimic the native membrane environment as closely as possible.

  • The oligomeric state of the CrcB homolog should be characterized and considered when interpreting interaction data.

  • The orientation of the protein (which faces the cytoplasm vs. periplasm/extracellular space) must be maintained in reconstituted systems.

These approaches provide a framework for systematically identifying and characterizing the interaction partners of CrcB homologs, offering insights into their cellular functions and regulatory mechanisms.

What controls are essential when working with Recombinant Pelobacter propionicus Protein CrcB homolog?

When working with Recombinant Pelobacter propionicus Protein CrcB homolog, implementing appropriate controls is critical for generating reliable and interpretable data:

• Expression and Purification Controls:

  • Negative control: Empty vector-transformed cells processed identically to identify background contamination.

  • Positive control: Well-characterized membrane protein expressed and purified in parallel to validate protocols.

  • Tag-only control: Expression of the tag without the CrcB protein to distinguish tag-specific effects from protein-specific effects.

• Storage Stability Controls:

  • Retention samples should be kept from each batch to monitor stability over time under the recommended storage conditions (-20°C for regular use, -80°C for extended storage) .

  • Comparative analysis of fresh versus stored samples should be performed to quantify any activity loss.

• Functional Assay Controls:

  • No-protein control: Assay buffer alone to establish baseline signals.

  • Denatured protein control: Heat-inactivated CrcB homolog to confirm activity is due to the correctly folded protein.

  • Related protein control: A different CrcB homolog (e.g., from Bacteroides vulgatus) to assess functional conservation and specificity .

• Specificity Controls for Interaction Studies:

  • Competition assays: Using unlabeled protein to compete with labeled protein in binding assays.

  • Mutant variants: Strategic mutations in predicted functional domains to correlate structure with observed activities.

  • Heterologous expression background: Testing activity in different host backgrounds to identify host-specific effects.

• Reconstitution Controls:

  • Empty liposomes/nanodiscs: To establish baseline properties of the membrane mimetic system.

  • Orientation controls: Assays to verify the directional insertion of the protein in membrane mimetics.

Proper implementation of these controls helps distinguish genuine biological activities of the CrcB homolog from experimental artifacts, enhancing the reliability and reproducibility of research findings.

How can I assess the functional activity of Recombinant Pelobacter propionicus Protein CrcB homolog in vitro?

Assessing the functional activity of Recombinant Pelobacter propionicus Protein CrcB homolog in vitro requires specialized approaches suitable for membrane proteins:

• Ion Channel/Transporter Activity Assays:

  • Liposome-based flux assays: The CrcB homolog can be reconstituted into liposomes containing ion-sensitive fluorescent dyes to monitor ion flux across membranes.

  • Planar lipid bilayer electrophysiology: For direct measurement of channel conductance, ion selectivity, and gating properties.

  • Solid-supported membrane electrophysiology: A higher-throughput alternative to planar lipid bilayers for preliminary characterization.

• Binding Assays:

  • Isothermal titration calorimetry (ITC): To measure thermodynamic parameters of ligand binding.

  • Microscale thermophoresis (MST): A solution-based technique requiring small amounts of protein for binding measurements.

  • Fluorescence-based ligand binding assays: Using environment-sensitive fluorophores to detect conformational changes upon ligand binding.

• Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy: To verify secondary structure content consistent with a properly folded membrane protein.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can report on the protein's folded state.

  • Limited proteolysis: To probe the accessibility of cleavage sites as an indicator of proper folding.

• Reconstitution Quality Control:

  • Freeze-fracture electron microscopy: To visualize protein incorporation into liposomes.

  • Dynamic light scattering (DLS): To assess size distribution and homogeneity of proteoliposomes.

  • Sucrose density gradient centrifugation: To separate empty liposomes from those containing protein.

When designing these assays, it's important to consider that the functional activity may be influenced by the lipid composition of the reconstitution system, the presence of specific ions, and the pH and temperature of the assay conditions. Systematic optimization of these parameters may be necessary to detect robust functional activity.

How can I address protein aggregation issues with Recombinant Pelobacter propionicus Protein CrcB homolog?

Protein aggregation is a common challenge when working with membrane proteins like the Recombinant Pelobacter propionicus Protein CrcB homolog. Here are systematic approaches to address this issue:

• Preventive Strategies During Expression:

  • Lower the expression temperature to 25°C or even 16°C to slow protein synthesis and improve folding .

  • Reduce inducer concentration to 0.1 mM IPTG or less to decrease expression rate .

  • Add chemical chaperones such as glycerol (5-10%) or specific osmolytes to the culture medium.

  • Consider co-expression with molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE.

• Extraction and Purification Optimization:

  • Screen multiple detergents systematically, beginning with mild non-ionic detergents (DDM, LMNG) before testing harsher options.

  • Include higher glycerol concentrations (up to 20%) in all buffers to stabilize the protein .

  • Add specific lipids during extraction that may be required for stability.

  • Incorporate detergent mixtures which sometimes perform better than single detergents.

• Post-Purification Stabilization:

  • Use size-exclusion chromatography to separate aggregates from properly folded protein.

  • Consider detergent exchange to more stabilizing detergents for long-term storage.

  • Test stabilization by specific additives (specific ions, ligands, or binding partners).

  • Explore nanodiscs or amphipols as alternatives to detergents for improved stability.

• Storage Considerations:

  • Store at -80°C for extended periods rather than -20°C if aggregation occurs during storage .

  • Add cryoprotectants beyond the standard 50% glycerol if needed .

  • Aliquot into smaller volumes to avoid repeated freeze-thaw cycles .

• Assessing and Quantifying Aggregation:

  • Dynamic light scattering (DLS) to monitor particle size distribution.

  • Analytical ultracentrifugation to characterize oligomeric states and aggregation.

  • Fluorescence-detection size-exclusion chromatography (FSEC) to assess protein homogeneity with high sensitivity.

By systematically addressing these aspects, researchers can significantly reduce aggregation issues and improve the yield of functional Recombinant Pelobacter propionicus Protein CrcB homolog.

What approaches can help resolve contradictory results in CrcB functional studies?

Resolving contradictory results in CrcB functional studies requires a systematic approach to identify and address potential sources of variability:

• Protein Preparation Variability:

  • Standardize expression conditions: Implement rigorous control of parameters like induction OD600, IPTG concentration, temperature, and duration .

  • Verify protein quality: Confirm batch-to-batch consistency through multiple quality control methods (SDS-PAGE, size-exclusion chromatography, mass spectrometry) .

  • Document purification history: Maintain detailed records of buffer compositions, detergents, and purification steps for each preparation.

• Experimental System Differences:

  • Membrane mimetic effects: Different reconstitution systems (detergent micelles, liposomes, nanodiscs) can significantly affect protein function.

  • Lipid composition influence: Systematically test the effects of different lipid compositions on protein activity.

  • Buffer composition variations: Create a matrix of conditions testing the effects of pH, ionic strength, and specific ions on observed functions.

• Methodological Approach:

  • Multi-method verification: Apply complementary techniques to validate findings (e.g., electrophysiology and flux assays for transport functions).

  • Blind testing protocols: Have different researchers test the same preparation using standardized protocols.

  • Inter-laboratory validation: Establish collaborations to verify key findings across different research groups.

• Data Analysis and Interpretation:

  • Statistical robustness: Ensure adequate replication (n≥3) and appropriate statistical analysis of results.

  • Outlier identification: Develop criteria for identifying and handling outlier data points.

  • Meta-analysis approach: Systematically compare conditions across multiple experiments to identify patterns in variability.

• Molecular Engineering Validation:

  • Structure-guided mutagenesis: Create mutations predicted to affect function and test whether the effects align with hypotheses.

  • Chimeric proteins: Swap domains between CrcB homologs with differing properties to map functional determinants .

By implementing these approaches, researchers can resolve contradictions and develop a more coherent understanding of CrcB homolog function across different experimental contexts.

How should I interpret circular dichroism data for membrane proteins like CrcB homologs?

Interpreting circular dichroism (CD) data for membrane proteins like CrcB homologs requires specialized considerations beyond those applied to soluble proteins:

• Sample Preparation Considerations:

  • Detergent background: Detergents can contribute significantly to CD spectra, particularly below 200 nm. Always prepare blank samples containing identical detergent concentrations.

  • Protein concentration determination: The presence of detergents can interfere with protein quantification methods, leading to normalization errors. Use multiple methods to verify concentration.

  • Light scattering effects: Aggregated samples can cause significant distortions through light scattering. Monitor sample clarity and consider correction algorithms.

• Spectral Interpretation Guidelines:

  • Expected features for CrcB homologs: Based on the amino acid sequence, CrcB homologs likely contain significant α-helical content, which would produce characteristic minima at 208 and 222 nm .

  • Quantitative analysis: Software packages like DICHROWEB, CDNN, or BeStSel can be used for deconvolution, but with caution regarding their reference sets for membrane proteins.

  • Reference database limitations: Standard reference sets may not adequately represent membrane proteins. Consider using specialized membrane protein reference sets where available.

• Comparative Analysis Framework:

  • Internal comparisons: Focus on relative changes between different conditions rather than absolute secondary structure predictions.

  • Temperature melts: Monitor the CD signal at 222 nm (for α-helical proteins) during heating to determine thermal stability and transition temperatures.

  • Ligand-induced changes: Small but reproducible spectral changes upon addition of potential ligands can indicate binding-induced conformational changes.

• Validation and Complementary Approaches:

  • Fourier-transform infrared spectroscopy (FTIR): Provides complementary secondary structure information less affected by some sample issues.

  • Hydrogen-deuterium exchange mass spectrometry: Can provide region-specific structural information to complement global CD measurements.

  • Predictive modeling: Compare experimental spectra with those predicted from homology models or computational predictions.

The table below provides a framework for interpreting CD spectral features in the context of membrane proteins like CrcB homologs:

By applying these specialized considerations, researchers can extract meaningful structural information from CD studies of CrcB homologs despite the additional challenges presented by membrane proteins.