Recombinant Pelobacter propionicus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

Enzymatic Activity

  • Catalytic function: Hydrolyzes Und-PP to Und-P (EC 3.6.1.27) .

  • Biological significance: Maintains Und-P pools required for glycan biosynthesis (e.g., peptidoglycan, O antigen) .

Association with Antibiotic Resistance

  • Bacitracin resistance: Bacitracin inhibits Und-P recycling by binding Und-PP; uppP counteracts this by regenerating Und-P .

  • Gene context: Encoded by the uppP gene (locus tag Ppro_3583) in Pelobacter propionicus .

Research Applications

Key Studies

  1. Cell Wall Biosynthesis: Used to investigate Und-P sequestration effects on E. coli morphology and peptidoglycan synthesis .

  2. Enzyme Kinetics: Assayed for substrate specificity and inhibition profiles .

  3. Structural Biology: Templates for crystallography or mutagenesis studies .

Experimental Compatibility

  • Formats: Lyophilized powder or glycerol-stocked solutions .

  • Recommended assays: SDS-PAGE, enzymatic activity assays, antibiotic resistance studies .

Comparative Analysis with Homologs

FeatureP. propionicus uppPAzospirillum brasilense uppP
Amino Acid Length273187
UniProt IDA1AV04P39438
Expression HostE. coliE. coli
Tag TypeVariableN-terminal His-tag

Industrial and Clinical Relevance

  • Antibiotic Development: Target for disrupting Und-P-dependent pathways in pathogenic bacteria .

  • Biotechnological Use: Tool enzyme for synthesizing lipid-linked oligosaccharides in vitro .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Ppro_3583; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Target Names
uppP
Target Protein Sequence
MNLLHALILGALQGVTEVLPISSSAHLILVPWLLGWPESGLTFDVALHLGTFLALVVYFR RDIVDMAVSTIDAVKHRSLDTPARRLPFLVIASAVPAALVGKLFETQIEELFRSRPLLIG LFLILFGVGLGLADLFGRKRRFMAQVTVSHALVIGLFQCLALIPGVSRSGITITAGLMLG FNRVGAARFSFLMSLPIVAGAALFKMLHLLDQGIPAGEGLPLAAGIVSSAVTGYISVAFL LRFVQKRSIAPFVWYRLIAGGAVVSVILTGISG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Undecaprenyl-diphosphatase in bacterial cell wall biosynthesis?

Undecaprenyl-diphosphatase catalyzes the dephosphorylation of undecaprenyl diphosphate (Und-PP) to generate undecaprenyl phosphate (Und-P), which serves as the essential lipid carrier for cell wall intermediates across the cytoplasmic membrane in bacteria. This conversion is critical for bacterial cell wall synthesis as Und-P ferries the building blocks required for peptidoglycan assembly . The reaction represents a critical recycling step in the lipid carrier cycle, ensuring continued availability of Und-P for ongoing cell wall biosynthesis. In bacterial species like P. propionicus, this enzyme likely plays a similar role to the well-characterized homologs in E. coli (BacA, PgpB, YbjG, and LpxT) .

What structural features distinguish bacterial Undecaprenyl-diphosphatases from other phosphatases?

Bacterial Undecaprenyl-diphosphatases belong to a specialized class of membrane-embedded enzymes with active sites oriented to interact with the hydrophobic undecaprenyl chain while catalyzing the cleavage of a terminal phosphate group. The catalytic mechanism typically involves metal ion coordination and specific amino acid residues positioned to facilitate nucleophilic attack on the phosphodiester bond of Und-PP . The enzyme's structure must accommodate the substantial hydrophobic 55-carbon isoprene chain of the substrate while positioning the diphosphate group appropriately for catalysis .

Which expression systems provide optimal yields of functionally active recombinant P. propionicus UppP?

For recombinant expression of Undecaprenyl-diphosphatase, multiple host systems can be employed with varying advantages:

Expression SystemAdvantagesLimitationsTypical YieldProcessing Time
E. coliHigh yield, rapid growth, economicalLimited post-translational modifications+++2-3 days
YeastGood yield, some post-translational modificationsMore complex media requirements++3-5 days
Insect cellsBetter post-translational modificationsLower yield, more technically demanding+7-10 days
Mammalian cellsFull range of post-translational modificationsLowest yield, highest cost+10-14 days

E. coli and yeast expression systems typically offer the best yields and shorter turnaround times for Undecaprenyl-diphosphatase production . For structural studies requiring higher purity but less concern for specific modifications, E. coli remains the system of choice. When enzyme activity depends on specific post-translational modifications, insect cells with baculovirus or mammalian expression systems may provide better retention of enzymatic function .

What purification strategy maximizes recovery of catalytically active P. propionicus UppP?

A multi-step purification protocol tailored for membrane proteins is essential for obtaining catalytically active UppP:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization with appropriate detergents (typically mild non-ionic detergents like DDM or LMNG)

  • Initial purification via metal affinity chromatography (if His-tagged)

  • Secondary purification through ion exchange chromatography

  • Final polishing via size exclusion chromatography

Throughout the purification process, it is critical to maintain appropriate detergent concentrations above the critical micelle concentration and include stabilizing agents such as glycerol to preserve the enzyme's native conformation and activity. Additionally, the inclusion of specific phospholipids during purification may help maintain the enzyme in a more physiologically relevant environment.

What assay systems effectively measure P. propionicus UppP activity and how are they optimized?

Several complementary approaches can be employed to assess UppP activity:

Radioactive Assay: Using 32P-labeled Und-PP substrate to directly measure release of inorganic phosphate.

Colorimetric Phosphate Detection: Employing malachite green or other colorimetric reagents to quantify released phosphate from the dephosphorylation reaction.

Coupled Enzyme Assays: Linking phosphate release to secondary enzymatic reactions that generate measurable signals (fluorescence or absorbance changes).

HPLC-Based Analysis: Directly measuring the conversion of Und-PP to Und-P through chromatographic separation.

Optimization requires careful consideration of:

  • Buffer composition (pH typically 6.5-8.0)

  • Presence of divalent cations (Mg2+, Mn2+, Ca2+)

  • Detergent type and concentration

  • Temperature (typically 25-37°C for mesophilic enzymes)

  • Substrate concentration range (for determining kinetic parameters)

How can researchers differentiate between the activities of multiple phosphatases that may act on Und-PP?

Differentiating between various Und-PP phosphatases requires a systematic approach:

  • Selective inhibition studies: Using specific inhibitors or compounds that differentially affect various phosphatase families

  • pH-activity profiling: Comparing activity across pH ranges where different phosphatases exhibit unique optima

  • Metal-ion dependency analysis: Evaluating activity with different divalent cations and chelating agents

  • Substrate specificity panels: Measuring activity against Und-PP versus other related substrates

  • Site-directed mutagenesis: Altering predicted catalytic residues to confirm mechanism

Researchers should implement controls using well-characterized phosphatases (like BacA from E. coli) alongside the P. propionicus UppP to establish reliable points of comparison .

What structural biology approaches provide insights into P. propionicus UppP catalytic mechanism?

Several complementary structural biology techniques can elucidate the catalytic mechanism:

  • X-ray Crystallography: For atomic-resolution structure determination, crystallization in lipidic cubic phases or with antibody fragments may facilitate crystal formation of this membrane protein.

  • Cryo-Electron Microscopy: Particularly useful for membrane proteins that resist crystallization, potentially revealing conformational states during catalysis.

  • Molecular Dynamics Simulations: To model substrate binding, transition states, and conformational changes during catalysis based on structural data.

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): For mapping conformational dynamics and substrate-induced changes in protein structure.

  • FTIR and Raman Spectroscopy: To characterize bond vibrations during catalysis and identify key intermediate states.

These approaches can reveal how the enzyme coordinates the undecaprenyl chain and positions the diphosphate group for nucleophilic attack, similar to studies conducted with other bacterial phosphatases .

How do researchers address data contradictions when characterizing substrate specificity of P. propionicus UppP?

When confronting contradictory data regarding substrate specificity, researchers should implement a systematic troubleshooting approach:

  • Standardize enzyme preparation: Ensure consistent expression, purification, and storage methods to minimize variability in enzyme quality.

  • Validate assay systems: Cross-verify results using multiple orthogonal assay technologies with appropriate controls.

  • Examine experimental conditions: Systematically vary pH, temperature, ionic strength, and detergent composition to identify condition-dependent effects.

  • Consider post-translational modifications: Compare enzyme preparations from different expression systems to identify potential modification-dependent activity .

  • Analyze enzyme heterogeneity: Use analytical techniques (size exclusion chromatography, native PAGE) to detect potential oligomeric states or conformational variants.

  • Collaborative verification: Engage independent laboratories to reproduce key findings using standardized protocols.

  • Computational modeling: Employ substrate docking and molecular dynamics simulations to provide theoretical support for experimental observations.

What genetic approaches can determine the physiological importance of P. propionicus UppP in cell wall biosynthesis?

To determine the physiological significance of UppP in P. propionicus, researchers can employ multiple genetic approaches:

  • Gene knockout/knockdown studies: Creating targeted deletions or using CRISPR interference to reduce UppP expression and assess impacts on cell growth, morphology, and wall integrity.

  • Complementation experiments: Testing whether UppP genes from other species can rescue UppP-deficient P. propionicus strains.

  • Conditional expression systems: Employing inducible promoters to control UppP expression and establish the minimal functional threshold required for viability.

  • Synthetic lethality screening: Identifying genetic interactions by combining UppP mutations with mutations in other cell wall biosynthesis genes, similar to approaches used in E. coli studies .

  • Suppressor mutation analysis: Identifying compensatory mutations that can rescue UppP deficiencies, revealing pathway redundancies or alternative mechanisms.

  • Reporter fusion constructs: Creating transcriptional or translational fusions to monitor UppP expression under various growth conditions.

These approaches can establish whether P. propionicus UppP, like its homologs in E. coli, is conditionally essential and reveal potential connections to other cellular processes .

How does P. propionicus UppP function integrate with broader cell wall homeostasis systems?

UppP function likely intersects with multiple cell systems beyond direct cell wall synthesis:

  • Cell division machinery: UppP activity may synchronize with divisome assembly to ensure appropriate peptidoglycan synthesis at the septum.

  • Signal transduction networks: Two-component systems like QseBC may respond to cell wall stress resulting from UppP dysfunction, similar to observations in E. coli where QseC deletion caused cell enlargement and lysis in Und-P metabolism-compromised strains .

  • DNA replication and repair systems: Genetic screening in E. coli has revealed unexpected connections between Und-P metabolism and DNA processes , suggesting potential similar linkages in P. propionicus.

  • Stress response pathways: Disruptions in UppP function may trigger envelope stress responses to maintain cell integrity during perturbations in lipid carrier cycling.

  • Glutathione metabolism: Connections identified in E. coli suggest redox systems may interface with Und-P metabolism , indicating potential similar relationships in P. propionicus.

Understanding these system-wide connections provides a framework for identifying potential new determinants of cell integrity that could serve as targets for future antimicrobial therapies .

How do the catalytic properties of P. propionicus UppP compare with UppP enzymes from other bacterial species?

A comprehensive comparison requires analysis across multiple parameters:

ParameterP. propionicus UppPE. coli BacAOther Gram-negative UppPsGram-positive UppPs
Kinetic efficiency (kcat/Km)Data not availableModerateVariableOften higher
pH optimumLikely 6.5-7.5~7.06.5-8.06.0-7.5
Metal ion requirementLikely Mg2+ dependentMg2+ dependentUsually Mg2+ or Mn2+Often Mg2+ dependent
Inhibitor sensitivityUnknownCharacterizedVariableGenerally more resistant
Membrane topologyPredicted multi-passMulti-passUsually multi-passMulti-pass with variations

Differences in catalytic properties often reflect adaptations to specific environmental niches or cell envelope architectures, particularly between Gram-negative and Gram-positive species. Identifying these differences could reveal species-specific vulnerabilities for targeted antimicrobial development.

What evolutionary insights emerge from phylogenetic analysis of P. propionicus UppP?

Phylogenetic analysis of UppP enzymes reveals:

  • Conservation patterns: Catalytic residues typically show high conservation across bacterial phyla, while peripheral regions may exhibit greater variability.

  • Horizontal gene transfer events: Analysis may reveal instances of horizontal acquisition, particularly in bacteria that have adapted to specialized environmental niches.

  • Functional divergence: Some bacterial lineages show evidence of gene duplication followed by functional specialization of UppP paralogs.

  • Co-evolution with cell wall structures: Correlation between UppP sequence features and specific cell wall architectures may reflect co-evolutionary processes.

  • Resistance mechanisms: Variations in UppP sequences may correlate with intrinsic resistance to certain antimicrobial compounds targeting cell wall biosynthesis.

Such evolutionary analysis can inform structure-function relationships and guide protein engineering efforts aimed at modifying UppP activity for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.