Recombinant Pelodictyon luteolum ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ftsH; Plut_0078; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-706
Protein Length
full length protein
Species
Chlorobium luteolum (strain DSM 273 / 2530) (Pelodictyon luteolum)
Target Names
ftsH
Target Protein Sequence
MAKNSLKPSNPYNSEPETPQPRPKLPMIYYVVVIALLIGLQLAFFWSGSSREIPYSTFRT FITENKVESVRIAPEKIYVTLKPGVDSGLPKQEEGNDTTRKLLPGAKTPENEVTVNPVRD ESLTALLETHGVRYEGSPGTTWISELIQWVLPFALLFGLYFFIFRRMGAGGPGAQFMNIG KNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPKKYTRLGGKLPKGVLLVGP PGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRDLFRQAKEKAPCIIFIDEI DAVGRSRGKGAMMGGNDERENTLNQLLVEMDGFATDKGVILMAATNRPDVLDPALLRPGR FDRQIMVDKPDLKGRMDTFRVHTKNMSLSPDVNLKALASQTPGFAGAEIANAANEAALLA SRRNKESIEMKDFEDAIERVVAGLEKKNKVINPKEKRIVAYHEAGHAIVSWMMPENDPVQ KISIVPRGMSALGYTMNIPLEDRYLMTKRELFARICGLLGGRIAEESVFGEISTGAQNDL EKITGIAYNMVMVYGMSDKIGNLSYYESNNPYYGAPGVEKKFGGETARLIDEEVKAIVES AADTVRTMLKEHRSKLEALARELLTKEMLQYCQIEEILGKRPGGQEEDSGEVDCSKKSAE NGMVAHEPETTADAESTEKVGLSATELAELEAAAERLRQSRNVSDN
Uniprot No.

Target Background

Function
This protein functions as an ATP-dependent, processive zinc metallopeptidase, targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is Recombinant Pelodictyon luteolum ATP-dependent zinc metalloprotease FtsH (ftsH)?

Recombinant Pelodictyon luteolum ATP-dependent zinc metalloprotease FtsH (ftsH) is a membrane-integrated ATP-dependent protease with the UniProt accession number Q3B6R3. It belongs to the FtsH family of proteases that are widely distributed across bacterial species. The protein is encoded by the ftsH gene (locus name: Plut_0078) in Pelodictyon luteolum (strain DSM 273), also known as Chlorobium luteolum (strain DSM 273) . The recombinant form is typically expressed with a tag to facilitate purification and experimental manipulation.

Similar to other FtsH proteases, P. luteolum FtsH likely functions in quality control of membrane and cytosolic proteins, participating in the targeted degradation of misfolded or damaged proteins. FtsH proteases are characterized by their dual ATPase and protease activities, with the latter requiring zinc as a cofactor for catalytic function .

What are the functional domains and their significance in P. luteolum FtsH?

The functional architecture of P. luteolum FtsH can be divided into distinct domains, each with specific roles:

DomainApproximate LocationFunction
N-terminal transmembraneN-terminusMembrane anchoring and potentially substrate recognition
AAA+ ATPaseCentral regionATP binding and hydrolysis, providing energy for protein unfolding
Zinc-binding proteaseC-terminal regionCatalytic site for peptide bond hydrolysis

The N-terminal transmembrane domain is critical for proper localization and function, as demonstrated in homologous proteins like T. FtsH from Thermus thermophilus. Studies have shown that soluble domains lacking these transmembrane helices retain neither ATPase nor protease activities . The AAA+ ATPase domain provides the mechanical force required for substrate unfolding through ATP hydrolysis, while the zinc-binding protease domain contains the catalytic site responsible for proteolytic activity. These domains work in concert to recognize, unfold, and degrade substrate proteins.

What experimental approaches are optimal for assessing P. luteolum FtsH protease activity?

For rigorous assessment of P. luteolum FtsH protease activity, researchers should implement a multi-faceted experimental design:

  • Substrate selection: Based on studies with homologous FtsH proteins, researchers should employ proteins with unfolded structures as substrates. Alpha-casein and pepsin have been demonstrated to effectively activate the ATPase activity of related FtsH proteases and are subsequently digested in an ATP- and Zn²⁺-dependent manner . For controlled experiments, alpha-lactalbumin provides an excellent model as it can exist in both folded and unfolded states, allowing researchers to demonstrate the specificity of FtsH for unfolded structures.

  • Reaction conditions: The protease assay should include:

    • Purified recombinant P. luteolum FtsH protein

    • ATP (typically 1-5 mM)

    • Zn²⁺ ions (0.1-1 mM)

    • Selected substrate protein

    • Appropriate buffer system (typically Tris-based)

  • Activity analysis: Monitor proteolytic activity through:

    • SDS-PAGE analysis of substrate degradation over time

    • Analysis of cleavage products by mass spectrometry to determine cleavage site specificity

    • Fluorescence-based assays using labeled substrates for kinetic studies

Based on findings from homologous FtsH proteins, researchers should specifically look for cleavage at the C-terminal side of hydrophobic residues and the generation of small peptides without large intermediates .

How can researchers distinguish between the ATPase and protease activities of P. luteolum FtsH?

Distinguishing between the ATPase and protease activities of P. luteolum FtsH requires systematic experimental approaches:

For ATPase activity assessment:

  • Employ a malachite green assay or an NADH-coupled assay to measure inorganic phosphate release

  • Test activation by various substrate proteins with different structural properties

  • Compare ATPase activity rates in the presence of structurally distinct proteins (e.g., folded vs. unfolded)

For protease activity analysis:

  • Use SDS-PAGE to visualize substrate degradation in parallel experiments with and without ATP

  • Design controls with ATP analogs that cannot be hydrolyzed (e.g., ATPγS)

  • Incorporate zinc chelators (e.g., EDTA) to demonstrate zinc-dependency

For correlation studies:

  • Plot ATPase activity rates against proteolytic rates under varying conditions

  • Generate point mutations in the ATPase domain to assess how impaired ATP hydrolysis affects proteolytic function

  • Characterize the relationship between ATP consumption and substrate processing efficiency

This systematic approach allows researchers to establish the mechanistic relationship between ATP hydrolysis and proteolytic activity, which appears to be coupled in FtsH proteins as demonstrated in homologous systems .

What role might P. luteolum FtsH play in stress response mechanisms?

Based on studies of FtsH in cyanobacteria, P. luteolum FtsH likely plays significant roles in stress response mechanisms:

  • Proteostasis maintenance: During abiotic stress, FtsH proteases help maintain proteostasis by degrading damaged or misfolded proteins that accumulate under stress conditions. In cyanobacteria, FtsH complexes have been shown to be crucial for cellular responses to various abiotic stresses .

  • Photosystem quality control: If P. luteolum FtsH functions similarly to cyanobacterial homologs, it may participate in the repair cycle of photosynthetic complexes, particularly Photosystem II, by removing damaged proteins for replacement. This function would be particularly important under high light stress or other conditions that damage photosynthetic apparatus .

  • Membrane integrity: The membrane localization of FtsH suggests a role in maintaining membrane protein quality under stress conditions that affect membrane fluidity or integrity.

To investigate these functions, researchers should design experiments that:

  • Compare FtsH expression and activity under normal and stress conditions

  • Analyze interaction partners of FtsH during stress responses

  • Characterize the degradome (set of degraded proteins) under different stress conditions

  • Assess the impact of FtsH depletion or overexpression on stress survival

What approaches are recommended for studying P. luteolum FtsH in membrane contexts?

Since the membrane segment of FtsH is critical for both ATPase and protease activities , studying P. luteolum FtsH in membrane contexts requires specialized approaches:

1. Membrane preparation and reconstitution:

  • Isolate native membranes or create proteoliposomes with defined lipid composition

  • Reconstitute purified P. luteolum FtsH into nanodiscs or liposomes to maintain its native membrane environment

  • Compare activity of membrane-embedded vs. detergent-solubilized protein

2. Membrane localization studies:

  • Use fluorescently tagged variants and confocal microscopy to determine subcellular localization

  • Apply immunogold electron microscopy for high-resolution localization

  • Perform membrane fractionation to identify specific membrane domains containing FtsH

3. Interaction with membrane components:

  • Investigate lipid preferences using lipidomics approaches

  • Identify membrane protein complexes associated with FtsH through crosslinking and co-immunoprecipitation

  • Assess whether specific lipid environments affect FtsH oligomerization and activity

4. Functional studies in membrane context:

  • Examine substrate processing at the membrane interface

  • Investigate how membrane fluidity affects FtsH activity

  • Study potential lateral movement within membranes using FRAP (Fluorescence Recovery After Photobleaching)

These approaches would provide insights into how the membrane environment influences P. luteolum FtsH function, which appears critical based on studies showing that soluble domains lacking transmembrane helices lose both ATPase and protease activities .

What advanced structural analysis techniques are suitable for P. luteolum FtsH?

Understanding the complex structure-function relationships of P. luteolum FtsH requires sophisticated structural analysis techniques:

1. Cryo-electron microscopy (cryo-EM):

  • Most suitable for resolving the hexameric structure of P. luteolum FtsH with near-atomic resolution

  • Can capture different conformational states during the ATP hydrolysis cycle

  • Particularly valuable for membrane-integrated complexes like FtsH where crystallization is challenging

  • Has been successfully used to resolve structures of related bacterial FtsH complexes

2. X-ray crystallography:

  • Applicable to soluble domains if the full-length protein proves challenging

  • Can provide high-resolution insights into catalytic sites and substrate-binding regions

  • May require extensive screening of crystallization conditions

3. Hydrogen/deuterium exchange mass spectrometry (HDX-MS):

  • Useful for mapping dynamic regions and conformational changes upon substrate binding or ATP hydrolysis

  • Can identify regions involved in protein-protein interactions

  • Provides information on solvent accessibility of different protein regions

4. Small-angle X-ray scattering (SAXS):

5. Integrative structural biology approaches:

  • Combining multiple techniques (e.g., cryo-EM, crosslinking-MS, molecular dynamics)

  • Creating composite models that incorporate data from various experimental sources

  • Computational modeling validated by experimental constraints

These techniques would help resolve fundamental questions about P. luteolum FtsH structure, including detailed atomic structures of the complexes, spatial arrangements of subunits, and conformational changes during the catalytic cycle .

How does P. luteolum FtsH compare to other bacterial FtsH proteases?

Comparative analysis of P. luteolum FtsH with other bacterial FtsH proteases reveals important similarities and differences:

FeatureP. luteolum FtsHE. coli FtsHT. thermophilus FtsHCyanobacterial FtsH
Cellular abundanceNot determined~660 copies/cellNot determinedFtsH1: <1,000 copies/cell
FtsH2/3/4: 1,800-5,950 copies/cell
Membrane locationPredicted membrane-integratedMembrane-integratedMembrane-integratedFtsH1: Plasma membrane
FtsH2/3/4: Thylakoid membrane
Substrate specificityPredicted to target unfolded proteinsWell-characterized for specific substratesRecognizes unfolded proteins, cleaves at C-terminal side of hydrophobic residues Multiple substrates including photosystem components
Complex formationPredicted hexamericHexamericHexamericHeterocomplexes (FtsH1/3, FtsH2/3) and homocomplexes (FtsH4)

What methodologies are recommended for investigating substrate specificity of P. luteolum FtsH?

Elucidating the substrate specificity of P. luteolum FtsH requires a systematic approach combining multiple methodologies:

1. Candidate substrate testing:

  • Screen potential substrates based on homology to known FtsH substrates from other bacteria

  • Test proteins with varying degrees of structural stability (folded vs. unfolded)

  • Analyze cleavage products by mass spectrometry to identify preferred cleavage sites

2. Proteome-wide approaches:

  • Conduct comparative proteomics analysis between wild-type and FtsH-depleted systems

  • Employ SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling to quantify protein abundance changes

  • Identify proteins with altered turnover rates when FtsH function is perturbed

3. Degradome analysis:

  • Directly identify cleavage products generated by P. luteolum FtsH using N-terminomics

  • Map cleavage sites to identify sequence motifs or structural features that determine susceptibility to FtsH degradation

  • Construct a position weight matrix representing preferred cleavage sites

4. Structural determinants of recognition:

  • Generate a library of model substrates with systematic variations in structure

  • Assess degradation kinetics as a function of substrate structural features

  • Employ hydrogen-deuterium exchange mass spectrometry to identify regions of substrate-enzyme interaction

5. Competition assays:

  • Design experiments with multiple substrates competing for degradation

  • Determine substrate preference hierarchies and kinetic parameters

  • Identify features that determine prioritization of certain substrates

Based on studies of homologous FtsH proteins, researchers should pay particular attention to the folding state of potential substrates, as FtsH preferentially recognizes unfolded structures, and should examine cleavage patterns for preference at the C-terminal side of hydrophobic residues .

How can researchers design experiments to elucidate the ATP dependency of P. luteolum FtsH?

To rigorously characterize the ATP dependency of P. luteolum FtsH, researchers should implement a comprehensive experimental design:

1. ATP concentration-response studies:

  • Measure both ATPase activity and proteolytic activity across a range of ATP concentrations (typically 0-5 mM)

  • Determine Km values for ATP in both activities

  • Analyze the correlation between ATP hydrolysis rates and proteolytic rates

2. Nucleotide specificity:

  • Compare activity with ATP versus other nucleotides (GTP, CTP, UTP)

  • Test non-hydrolyzable ATP analogs (ATPγS, AMP-PNP) to determine if ATP binding alone is sufficient or if hydrolysis is required

  • Examine the effects of ADP as a potential competitive inhibitor

3. Site-directed mutagenesis:

  • Generate mutations in key residues of the Walker A and B motifs in the ATPase domain

  • Assess the impact of these mutations on both ATP hydrolysis and proteolytic activity

  • Create a library of mutations with varying degrees of ATPase impairment to establish the quantitative relationship between these activities

4. Real-time coupling analysis:

  • Develop assays that simultaneously measure ATP hydrolysis and substrate degradation

  • Determine the ATP:substrate stoichiometry (ATP molecules consumed per peptide bond cleaved)

  • Characterize the temporal relationship between ATP hydrolysis events and proteolytic events

5. Structural studies during ATP hydrolysis cycle:

  • Use rapid-freezing cryo-EM to capture structural states during the ATP hydrolysis cycle

  • Identify conformational changes that couple ATP hydrolysis to substrate processing

  • Map the transmission of force from the ATPase domain to the protease domain

These approaches would build upon observations from homologous systems showing that ATP hydrolysis is required for the proteolytic activity of FtsH, with the protein digesting substrates in an ATP-dependent manner .

What expression systems are recommended for producing active recombinant P. luteolum FtsH?

Producing active recombinant P. luteolum FtsH presents challenges due to its membrane integration and complex structure. Recommended expression systems include:

1. E. coli-based systems:

Advantages:

  • Well-established protocols and genetic tools

  • Rapid growth and high protein yields

  • Successfully used for homologous FtsH proteins

Optimizations:

  • Use E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Employ low-temperature induction (16-20°C) to favor proper folding

  • Consider fusion tags that enhance membrane protein folding (e.g., Mistic, SUMO)

  • Use a controlled expression system like the arabinose-inducible pBAD vector

2. Cell-free expression systems:

Advantages:

  • Direct control over reaction conditions

  • Ability to add lipids or detergents during synthesis

  • Avoids toxicity issues that might occur in living cells

Optimizations:

  • Supplement with E. coli membrane fractions or nanodiscs

  • Include zinc and ATP in the reaction mixture

  • Optimize translation enhancing elements

3. Baculovirus-insect cell system:

Advantages:

  • Superior folding of complex proteins

  • Post-translational modifications more similar to native

  • Better tolerance for membrane proteins

Optimizations:

  • Use the strong polyhedrin promoter for high expression

  • Optimize codon usage for insect cells

  • Include a secretion signal if enhanced membrane targeting is desired

Purification considerations:

  • Use mild detergents (DDM, LMNG) for extraction

  • Include ATP and zinc in all buffers to stabilize the protein

  • Consider nanodiscs or amphipols for detergent-free handling

  • Verify hexameric assembly by size exclusion chromatography

These recommendations are based on successful approaches for expressing and purifying homologous FtsH proteins, particularly noting that membrane segments are critical for activity .

How can P. luteolum FtsH be used as a model to understand stress adaptation mechanisms?

P. luteolum FtsH offers valuable opportunities as a model system for understanding stress adaptation mechanisms in bacteria:

1. Comparative stress biology studies:

  • Compare the function and regulation of P. luteolum FtsH with homologs from organisms in different ecological niches

  • Assess how FtsH adaptations reflect environmental challenges faced by different bacterial species

  • Investigate species-specific substrate preferences that may relate to unique stress responses

2. Stress-induced regulation mechanisms:

  • Characterize transcriptional and post-translational regulation of P. luteolum FtsH under various stress conditions

  • Identify regulatory proteins that modulate FtsH activity during stress

  • Map stress-response pathways that involve FtsH activation or regulation

3. Targeted degradation under stress:

  • Identify substrates specifically degraded by P. luteolum FtsH during particular stress conditions

  • Characterize the kinetics of stress-induced protein degradation

  • Determine how substrate selection changes under different stress scenarios

4. Evolutionary adaptation analysis:

  • Compare P. luteolum FtsH with homologs from bacteria facing similar environmental challenges

  • Identify conserved features that may represent essential stress-response elements

  • Analyze divergent features that might reflect species-specific adaptations

5. Synthetic biology applications:

  • Engineer P. luteolum FtsH with modified substrate specificity for novel stress responses

  • Design synthetic stress response circuits incorporating FtsH

  • Create biosensors based on FtsH activity that respond to specific stress conditions

This research framework builds upon our understanding of FtsH complexes in cyanobacteria, where they play crucial roles in abiotic stress responses, particularly in maintaining photosynthetic apparatus under adverse conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.