Recombinant Pelodictyon luteolum ATP synthase subunit a 2 (atpB2)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Expression System:

  • Produced in E. coli with an N-terminal His tag for affinity purification .

  • Full-length protein (1–175 aa for atpF2; 34–341 aa for atpB2) is expressed and purified to >90% purity via SDS-PAGE .

Proton Translocation Mechanism:

  • Subunit a 2 interacts with the c-ring (atpE-2) to direct protons through membrane-embedded half-channels .

  • Each proton binds to a glutamate residue on the c-ring, inducing rotational motion that drives ATP synthesis .

Thermodynamic Efficiency:

  • ATP synthesis efficiency depends on the c-ring stoichiometry (8–17 c-subunits per ring), with atpB2 influencing proton coupling ratios .

  • Studies on homologous ATP synthases indicate a threshold electrochemical gradient of ~90 mV for ATP synthesis .

Allosteric Regulation:

  • Rotary ATPases, including atpB2-containing complexes, are modulated by secondary messengers (e.g., cyclic di-GMP) that bind to ATPase subunits .

Outstanding Research Questions

  • Stoichiometry Variability: How does atpB2 influence c-ring subunit count across species ?

  • Regulatory Pathways: Are there undiscovered allosteric modulators of atpB2 in P. luteolum ?

  • Evolutionary Conservation: Comparative studies with bacterial F-type and eukaryotic V-type ATPases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
atpB2; Plut_2098; ATP synthase subunit a 2; ATP synthase F0 sector subunit a 2; F-ATPase subunit 6 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-341
Protein Length
Full Length of Mature Protein
Species
Chlorobium luteolum (strain DSM 273 / 2530) (Pelodictyon luteolum)
Target Names
atpB2
Target Protein Sequence
EEHAAPVAAVVAAHAEAAVDPALEPAHAEPAGHEDEKAGDVIMHHILNSHSFSFEPFGTI HLPTLPPVFGIDISITKHVVMLWIVSAILLVLFSFVGAAYRKITPKTAPSGVANTMEALV EFIRLDVAKSNIGHGYEAHLPYLLTVFMFILLCNILGLIPYGATATGNINVTLTLAVFTF FITQAASLKAHGLKGYLTHLTAGTHWSLWIIMIPIEVIGLFTKPFALTVRLFANMTAGHI VILSLIFISFILKSYVVAAAVSVPFSIFIYLLEIFVAFLQAFIFTMLSALFIGLATAHEG GEAEAAHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit a 2 (atpB2) in Pelodictyon luteolum?

ATP synthase subunit a 2 plays a critical role in ion translocation across the membrane, forming part of the stator complex that interacts with the c-ring rotor during ATP synthesis. Based on studies of similar ATP synthases, the subunit a 2 likely contains ion-binding sites that facilitate the passage of ions (either H+ or Na+) through the membrane domain of the enzyme. This ion movement drives the rotation of the c-ring, which ultimately powers ATP synthesis at the catalytic sites .

The functional mechanism involves:

  • Formation of ion access channels from the periplasm to the c-ring binding sites

  • Coordination of ion binding and release during rotary catalysis

  • Maintenance of the proton-motive force or sodium-motive force coupling

In anaerobic organisms like Pelodictyon luteolum, the ATP synthase may operate with very small driving forces, suggesting specialized adaptations in the a subunit structure to maximize energy conversion efficiency .

How do researchers differentiate between subunit a variants in Pelodictyon luteolum?

Differentiating between ATP synthase subunit variants requires a multi-faceted approach:

  • Sequence analysis: Comparing nucleotide and amino acid sequences to identify conserved motifs and variant-specific regions.

  • Expression pattern analysis: Examining differential expression under varying environmental conditions.

  • Structural prediction: Using computational tools to predict structural differences that might impact function.

  • Functional assays: Measuring ATP synthesis/hydrolysis rates under controlled conditions.

Gene knockout studies combined with complementation using specific variants can help determine the functional importance of each subunit variant. For subunit a 2 specifically, researchers should examine conserved residues involved in ion binding and translocation to determine its unique properties compared to other variants .

What are the optimal methods for expressing and purifying recombinant Pelodictyon luteolum atpB2?

Based on successful approaches with other ATP synthases, the following methods are recommended:

Expression system selection:

  • E. coli expression systems like BL21(DE3) with pET-based vectors are typically effective

  • Codon optimization of the Pelodictyon luteolum sequence for E. coli is crucial for efficient expression

  • Addition of an N-terminal or C-terminal affinity tag (His6) facilitates purification while minimizing functional interference

Expression conditions:

  • Induction at lower temperatures (16-18°C) for extended periods (16-20 hours) often improves membrane protein folding

  • IPTG concentration of 0.1-0.5 mM is typically sufficient for induction

  • Addition of membrane-stabilizing agents like glycerol (5-10%) to the growth medium

Purification protocol:

  • Cell membrane preparation via differential centrifugation

  • Solubilization using mild detergents (DDM at 0.1-1% is commonly effective)

  • Affinity chromatography using Ni-NTA or similar matrix

  • Size exclusion chromatography for further purification

Quality control methods:

  • SDS-PAGE and Western blotting to confirm identity and purity

  • Circular dichroism to assess secondary structure integrity

  • Limited proteolysis to verify proper folding

How can researchers reconstitute purified recombinant atpB2 for functional studies?

Reconstitution into liposomes provides the most effective system for functional studies of membrane proteins like atpB2. Based on protocols described for other ATP synthases, the following methodology is recommended:

  • Liposome preparation:

    • Use phosphatidylcholine type II S from soybeans (100 mg/mL in appropriate buffer)

    • Sonicate the mixture (20 min at 4°C using 60W, 30% amplitude, 0.5-s intervals)

    • Achieve translucent small unilamellar vesicles

  • Protein incorporation:

    • Add purified ATP synthase containing atpB2 to the liposome suspension

    • Maintain lipid:protein ratio of approximately 30:1

    • Add 0.1% DDM (w/v) to enhance reconstitution in the correct orientation

    • Incubate for 30 min at 4°C

  • Detergent removal:

    • Add Bio-Beads (80 mg) in increments after incubation periods (1h, 2h, 4h)

    • Collect proteoliposomes by ultracentrifugation (150,000 × g for 30 min)

    • Resuspend in appropriate buffer for functional assays

  • Verification of reconstitution:

    • Freeze-fracture electron microscopy to visualize protein insertion

    • ATP hydrolysis assays to confirm enzyme activity

    • Fluorescent probes to verify generation of membrane potential or ion gradients

What methods are most effective for measuring ATP synthesis activity of reconstituted systems containing atpB2?

After successful reconstitution, ATP synthesis activity can be measured using the following approaches:

  • Generation of ion gradients:

    • Apply artificial driving forces through ion concentration gradients (ΔpNa or ΔpH)

    • Create membrane potential (Δψ) using potassium diffusion potential with valinomycin

    • Calculate total driving force (ΔμNa+/F or ΔμH+/F) using the equation:
      ΔμIon/F = Δψ + z·ΔpH/ΔpNa

  • ATP synthesis measurement:

    • Add ADP and phosphate to the proteoliposome suspension

    • Monitor ATP production using luciferase-based luminescence assays

    • Calculate synthesis rates in nmol·min⁻¹·mg protein⁻¹

  • Control reactions:

    • Include protonophores (e.g., TCS) or ionophores (e.g., ETH2120) to verify gradient dependence

    • Perform assays without ADP to confirm ATP synthesis rather than contamination

    • Test various ion gradients and membrane potentials to determine threshold values

Driving Force (mV)ATP Synthesis Rate (nmol·min⁻¹·mg protein⁻¹)
70-80~0 (below threshold)
90-10010-20 (threshold range)
150-20050-80 (mid-range activity)
>20080-100 (maximum activity)

Table 1: Expected ATP synthesis rates based on driving force magnitude, extrapolated from similar ATP synthases

How does the energetic threshold for ATP synthesis by recombinant atpB2-containing ATP synthase compare to other bacterial ATP synthases?

The energetic threshold for ATP synthesis represents a critical parameter for understanding the bioenergetic efficiency of ATP synthases. For recombinant Pelodictyon luteolum ATP synthase containing atpB2, this threshold can be determined experimentally:

  • Experimental approach:

    • Vary the potassium diffusion potential at constant Na+ concentration

    • Maintain internal NaCl concentration constant while varying external NaCl

    • Measure ATP synthesis rates at different driving force values

  • Expected findings:

    • Based on studies of similar ATP synthases, the threshold value is likely between 80-90 mV

    • Both Δψ and ΔpNa may serve as nearly equal driving forces for ATP synthesis

    • The total driving force (ΔμNa+/F) rather than individual components likely determines synthesis rates

Comparative analysis with other ATP synthases:

ATP Synthase SourceThreshold (mV)Optimal Range (mV)Ion Specificity
E. callanderi87-90150-230Na+
E. coli120-140200-250H+
P. modestum90-100160-220Na+
Pelodictyon luteolum*80-90*140-220*Unknown*

*Table 2: Comparative threshold values for ATP synthesis (predicted values based on similar enzymes)

The capability to synthesize ATP at relatively low driving forces (80-90 mV) would place Pelodictyon luteolum among the more efficient ATP synthases, suggesting adaptations to energy-limited environments .

What structural features of atpB2 contribute to ion specificity and how can these be experimentally determined?

Understanding ion specificity (Na+ vs. H+) is crucial for characterizing ATP synthases. For atpB2, several approaches can determine this property:

  • Sequence analysis:

    • Identify conserved motifs associated with Na+ or H+ binding in subunit a

    • Compare with known Na+-specific and H+-specific ATP synthases

    • Focus on residues known to form ion binding sites in homologous structures

  • Site-directed mutagenesis:

    • Target conserved residues predicted to be involved in ion binding

    • Create single and multiple amino acid substitutions

    • Analyze effects on ATP synthesis under varying Na+ and H+ gradients

  • Ion dependence assays:

    • Measure ATP synthesis rates with:

      • Varying Na+ concentrations at constant pH

      • Varying pH at constant Na+ concentration

      • Different cation species to test specificity

  • Inhibitor studies:

    • Test sensitivity to specific Na+ channel inhibitors versus protonophores

    • Analyze competitive binding of ions using kinetic measurements

Expected structural features involved in ion specificity:

  • Precise arrangement of polar and charged residues in transmembrane helices

  • Specific hydrogen-bonding networks that facilitate ion binding and release

  • Strategic positioning of conserved acidic residues (Asp, Glu) in the ion path

What strategies are effective for genetic manipulation of atpB2 to study structure-function relationships?

Several genetic approaches can be used to study structure-function relationships in atpB2:

  • Creation of chimeric constructs:

    • Design fusion proteins combining domains from different ATP synthase subtypes

    • Follow strategies similar to those used for bacteriophage tail fiber modifications

    • Create chimeras between atpB2 and homologous subunits from different species

  • Site-directed mutagenesis approaches:

    • Target conserved residues in ion channels

    • Create conservative and non-conservative substitutions

    • Develop alanine-scanning libraries across key functional regions

  • Deletion and truncation analysis:

    • Generate systematic truncations to identify minimal functional domains

    • Create internal deletions to map functional regions

    • Develop complementation assays to test functional rescue

  • Genetic tools for manipulation:

    • CRISPR-Cas9 for precise genomic modifications

    • Gibson Assembly for seamless construction of complex genetic elements

    • Lambda Red recombination for chromosome engineering

Validation approaches:

  • Complementation studies in ATP synthase-deficient strains

  • Growth assays under conditions requiring ATP synthase function

  • Direct measurement of ATP synthesis activity after reconstitution

How can heterologous expression systems be optimized for production of functional atpB2?

Optimizing heterologous expression requires careful consideration of several factors:

  • Host selection considerations:

    • E. coli strains C41(DE3) or C43(DE3) specifically engineered for membrane proteins

    • Cell-free expression systems for toxic or difficult-to-express proteins

    • Consideration of Bacillus subtilis or other bacterial hosts if E. coli is problematic

  • Expression vector optimization:

    • Use of low-copy vectors to prevent toxicity

    • Inducible promoters with tight regulation (pBAD, Tet-responsive)

    • Inclusion of proper signal sequences for membrane targeting

  • Fusion partners to enhance expression:

    • N-terminal fusions with MBP or SUMO to improve solubility

    • C-terminal fusions with GFP to monitor expression and folding

    • Inclusion of cleavable tags for post-purification removal

  • Expression conditions optimization:

    • Temperature reduction to 16-20°C during induction

    • Addition of membrane-stabilizing compounds (glycerol, betaine)

    • Co-expression with chaperones specific for membrane proteins

  • Scale-up considerations:

    • Transition from shake flask to bioreactor cultivation

    • Fed-batch strategies to achieve higher cell densities

    • Oxygen limitation to mimic native conditions for anaerobic proteins

How should researchers interpret contradictory results in ATP synthase activity assays?

When facing contradictory results in ATP synthase activity assays, consider the following analytical approach:

  • Systematic error identification:

    • Verify integrity of membrane potential and ion gradients

    • Check for contaminating ATPases in the preparation

    • Ensure correct orientation of the enzyme in liposomes

    • Validate ADP purity and absence of ATP contamination

  • Resolution strategies:

    • Implement multiple independent activity measurement methods

    • Use specific inhibitors to distinguish between different ATPases

    • Perform time-course experiments to identify transient activities

    • Vary lipid composition to optimize membrane environment

  • Statistical analysis framework:

    • Apply paired experimental designs to minimize variation

    • Utilize ANOVA for multi-variable experiments

    • Perform power analysis to ensure sufficient replication

    • Implement Bayesian approaches for complex data interpretation

  • Common pitfalls and solutions:

ContradictionPossible CauseResolution Strategy
No ATP synthesis despite intact gradientIncorrect orientation in liposomesUse ionophores to verify gradient; try different reconstitution methods
Activity in controls without gradientATP contamination or ATP synthesis via substrate-level phosphorylationUse highly purified ADP; include hexokinase trap
Inconsistent threshold valuesGradient instabilityUse fluorescent probes to directly measure gradient; optimize buffer composition
Variable activity between preparationsHeterogeneity in reconstitutionStandardize liposome size via extrusion; verify protein incorporation rates

What are the best practices for investigating ion specificity of ATP synthase containing atpB2?

Determining ion specificity requires systematic experimental approaches:

  • Experimental design principles:

    • Isolate variables by maintaining constant pH when varying Na+ concentration

    • Create precise ion gradients using calibrated buffers and ion-selective electrodes

    • Implement parallel experiments with known Na+- and H+-dependent ATP synthases as controls

  • Key measurements:

    • ATP synthesis rates as a function of Na+ concentration at fixed ΔpH

    • ATP synthesis rates as a function of ΔpH at fixed Na+ concentration

    • Inhibition profiles using specific Na+ channel blockers versus protonophores

  • Data interpretation framework:

    • Plot Hill curves to determine ion binding cooperativity

    • Calculate half-maximal effective concentrations (EC50) for different ions

    • Develop kinetic models to distinguish between alternative mechanisms

  • Validation approaches:

    • Site-directed mutagenesis of predicted ion-binding residues

    • Isotope exchange experiments to directly track ion movements

    • Fluorescent probes to monitor ion movements in real-time

By systematically testing different conditions and applying rigorous controls, researchers can confidently determine the ion specificity of the ATP synthase containing atpB2 .

How might genetic engineering approaches be used to modify the properties of atpB2 for research applications?

Building on principles demonstrated in bacteriophage research, several engineering approaches could be applied to atpB2:

  • Domain swapping strategies:

    • Exchange ion-binding domains between Na+- and H+-specific ATP synthases

    • Create chimeric constructs between atpB2 and subunits from organisms with different energetic thresholds

    • Engineering approach similar to bacteriophage tail fiber modifications for altered specificity

  • Targeted mutagenesis approaches:

    • Introduce mutations to modify the energetic threshold for ATP synthesis

    • Alter ion specificity through modification of binding sites

    • Engineer pH-responsive elements for controlled activity

  • Applications of engineered variants:

    • Development of biosensors for measuring small membrane potentials

    • Creation of model systems for studying bioenergetics at low driving forces

    • Design of minimal ATP synthase systems for synthetic biology applications

  • Experimental validation methods:

    • Liposome reconstitution with defined gradients

    • Direct measurement of ATP synthesis under varying conditions

    • Structural studies to confirm engineered changes

The principles of genetic manipulation demonstrated in bacteriophage research, where single gene modifications successfully altered receptor specificity, suggest similar approaches could be effective for modifying atpB2 properties .

What potential role does atpB2 play in the adaptations of Pelodictyon luteolum to its unique ecological niche?

Understanding the ecological significance of atpB2 requires integrating bioenergetic data with ecological knowledge:

  • Ecological context analysis:

    • Examine the energy-limited environments where Pelodictyon luteolum thrives

    • Consider the thermodynamic constraints of anaerobic ecosystems

    • Analyze competitive advantages of efficient ATP synthesis at low driving forces

  • Comparative genomics approach:

    • Compare atpB2 sequences across related organisms from diverse environments

    • Identify signature adaptations correlated with specific ecological parameters

    • Examine gene expression under different environmental conditions

  • Biochemical adaptations to environment:

    • Study temperature dependence of ATP synthesis efficiency

    • Investigate salt tolerance and its relationship to Na+ specificity

    • Analyze the impact of pH fluctuations on enzyme function

  • Evolutionary considerations:

    • Examine the evolutionary history of atpB2 through phylogenetic analysis

    • Identify potential horizontal gene transfer events that shaped its evolution

    • Compare with ATP synthases from archaea that operate near the thermodynamic limit

The ability to function at driving forces as low as 80-90 mV would represent a significant adaptation to energy-limited environments, potentially explaining Pelodictyon luteolum's success in its ecological niche .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.