Recombinant Pelodictyon luteolum Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lspA; Plut_0482; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Chlorobium luteolum (strain DSM 273 / 2530) (Pelodictyon luteolum)
Target Names
lspA
Target Protein Sequence
MKMFSMLALFVIAADQFTKKLAVFFLRDMQQSITIIPDFFSFTYAENRGVAFGMEFAPPF VLLMLTGAIVLGVLVFVARSRNRTPIFLSAFGLIAGGGIGNMIDRIASGRVTDFIYFDLY KGELFGHWVSLWPIFNVADSAITIGACMLVLFYNRIFPDTEETRHAG
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (LspA) and what is its significance in bacterial systems?

Lipoprotein signal peptidase (LspA) is an aspartyl protease that serves a critical function in the lipoprotein-processing pathway of bacteria. It specifically cleaves the transmembrane helix signal peptide of lipoproteins, a crucial step in bacterial lipoprotein maturation. The significance of LspA extends beyond basic bacterial physiology as it represents an excellent target for antibiotic development for several reasons: it is essential in Gram-negative bacteria, plays important roles in virulence for Gram-positive bacteria, and appears to have a low propensity for developing antibiotic resistance . The Pelodictyon luteolum LspA (EC 3.4.23.36), also known as prolipoprotein signal peptidase or signal peptidase II (SPase II), follows this general functional pattern within its specific bacterial context .

What are the structural characteristics of Pelodictyon luteolum LspA?

Pelodictyon luteolum LspA is a membrane-embedded enzyme with a full-length sequence of 167 amino acids. Its primary sequence (MKMFSmLALFVIAADQFTKKLAVFFLRDMQQSITIIPDFFSFTYAENRGVAFGMEFAPPFVLLmLTGAIVLGVLVFVARSRNRTPIFLSAFGLIAGGGIGNMIDRIASGRVTDFIYFDLYKGELFGHWVSLWPIFNVADSAITIGACmLVLFYNRIFPDTEETRHAG) contains hydrophobic regions consistent with its membrane localization . While the specific crystallographic structure of P. luteolum LspA has not been reported in the provided search results, research on homologous LspA proteins reveals a structure featuring transmembrane domains, a periplasmic helix (PH), and a β-cradle region that are essential for its function . The catalytic mechanism involves an aspartyl dyad within the active site that is highly conserved across bacterial species, suggesting similar structural elements in the P. luteolum enzyme.

What optimal conditions should be maintained for storing recombinant P. luteolum LspA?

For optimal preservation of recombinant P. luteolum LspA activity, the protein should be stored in a Tris-based buffer with 50% glycerol. Short-term storage (up to one week) can be maintained at 4°C, while longer-term storage requires -20°C conditions. For extended preservation periods, -80°C storage is recommended . Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and enzymatic activity. Working aliquots should be prepared to minimize the number of freeze-thaw cycles required for experimental work .

What expression systems are most effective for producing recombinant P. luteolum LspA?

While the search results don't specifically detail expression systems for P. luteolum LspA, extrapolation from research on homologous proteins suggests that prokaryotic expression systems, particularly E. coli-based systems with membrane protein expression capabilities, would be most appropriate. Given the membrane-embedded nature of LspA, expression systems utilizing strains like C41(DE3) or C43(DE3) that are specialized for membrane protein expression may provide better yields. The addition of fusion tags (either N- or C-terminal) can facilitate purification while maintaining enzymatic activity. The tag selection should be determined during the production process to optimize for protein stability and function .

How can researchers effectively measure the conformational dynamics of LspA?

Researchers can employ a hybrid experimental approach combining molecular dynamics (MD) simulations with electron paramagnetic resonance (EPR) spectroscopy to effectively characterize LspA conformational dynamics. Continuous wave (CW) EPR provides insights into nanosecond timescale dynamics, while double electron-electron resonance (DEER) spectroscopy can measure longer-range distances between spin labels incorporated at strategic positions within the protein structure .

The combination of these techniques has revealed that LspA undergoes significant conformational changes, particularly in its periplasmic helix (PH), which fluctuates on the nanosecond timescale. This approach has identified at least three distinct conformational states:

  • A closed conformation where the PH occludes the charged active site from the lipid bilayer

  • An intermediate conformation that may represent the antibiotic-bound state

  • An open conformation that allows substrate binding

For P. luteolum LspA specifically, these experimental approaches would need to be adapted based on the specific amino acid sequence and predicted structural features.

How does LspA accommodate different lipoprotein substrates despite having a conserved active site?

LspA demonstrates remarkable flexibility in substrate recognition, being able to process various lipoprotein substrates despite having a highly conserved active site. This adaptability appears to be facilitated by the protein's conformational dynamics. Research using MD simulations and EPR shows that the periplasmic helix (PH) of LspA fluctuates between different conformational states, with the dominant conformation in the apo state being the most closed, which occludes the charged active site from the lipid bilayer .

The protein samples multiple conformations including closed, intermediate, and open states, with the open conformation being the only one that sterically allows the prolipoprotein substrate to enter and bind in the active site in the correct orientation for signal peptide cleavage. This conformational plasticity explains how LspA can accommodate and process a variety of substrates while maintaining its essential catalytic functionality .

What is the potential of LspA as an antibiotic target, and what research approaches can advance this application?

LspA represents a promising antibiotic target due to several key characteristics:

  • It is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria

  • Its active site contains highly conserved residues (the catalytic dyad and 14 additional conserved residues)

  • Mutations that would impede antibiotic binding would likely also interfere with substrate binding and cleavage

Research approaches to advance LspA-targeted antibiotic development should include:

  • Structure-guided drug design based on the binding modes of known LspA inhibitors like globomycin and myxovirescin

  • Investigation of the conformational dynamics of LspA in different states (apo, antibiotic-bound, substrate-bound)

  • Development of high-throughput screening assays to identify novel inhibitors

  • Comparative studies across LspA homologs from different bacterial species to identify species-specific vulnerabilities

The antibiotic globomycin has been shown to stabilize an intermediate conformation of LspA that inhibits both signal peptide cleavage and substrate binding . Understanding these conformational states and how they can be exploited by inhibitors provides a foundation for rational drug design efforts.

How does P. luteolum LspA compare to homologs from other bacterial species?

While direct comparative data for P. luteolum LspA is limited in the search results, insights can be drawn from studies of other bacterial LspA proteins. Research has characterized LspA from Pseudomonas aeruginosa (LspPae) and Staphylococcus aureus (LspMrs), revealing structural similarities but also distinct conformational behaviors . All LspA proteins share a conserved catalytic dyad and approximately 14 additional highly conserved residues surrounding the active site.

P. luteolum is classified within the Chlorobiaceae family in the phylum Chlorobi (green sulfur bacteria) , suggesting its LspA may have evolved specific adaptations related to its ecological niche. In comparative genomic contexts, P. luteolum appears in analyses alongside other bacteria such as Desulfurobacterium thermolithotrophum , indicating potential evolutionary relationships that may be reflected in structural and functional similarities of their respective LspA proteins.

What is the role of LspA in single-species ecosystems and how does this inform research approaches?

In extreme environments where single-species ecosystems exist, such as the deep subsurface fracture zones described in the search results , proteins like LspA play essential roles in maintaining cellular function. While the search results don't specifically discuss P. luteolum in such contexts, they do mention P. luteolum in the context of studies examining minimal genomes and self-sufficient organisms .

In such specialized environments, essential genes like lspA likely experience strong selective pressure, as evidenced by the low single nucleotide polymorphism (SNP) rates observed in similar single-species ecosystems . This suggests that for organisms like P. luteolum that may exist in specialized ecological niches, LspA function is likely highly optimized and essential.

Research approaches studying LspA in such contexts should consider:

  • The selective pressures exerted on the lspA gene in different environmental conditions

  • The potential specialization of LspA function in organisms adapted to extreme or specialized habitats

  • The essential nature of LspA in maintaining cellular function in minimal genomes

What emerging technologies can enhance our understanding of LspA conformational dynamics?

Building upon current approaches using MD simulations and EPR, several emerging technologies hold promise for deepening our understanding of LspA conformational dynamics:

  • Cryo-electron microscopy (cryo-EM) to capture LspA in different conformational states within a native-like lipid environment

  • Time-resolved X-ray crystallography to observe conformational changes during the catalytic cycle

  • Advanced computational approaches combining AI-based protein structure prediction with molecular dynamics

  • Single-molecule FRET (Förster Resonance Energy Transfer) to observe conformational changes in real-time

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of conformational flexibility

The hybrid experimental approach combining computational and spectroscopic methods has already revealed protein conformations not previously observed in crystal structures , suggesting that continued integration of multiple techniques will yield the most comprehensive understanding of LspA function.

How can LspA research contribute to addressing antibiotic resistance?

Research on LspA can contribute significantly to addressing antibiotic resistance through several pathways:

  • Development of novel antibiotics targeting essential bacterial processes with low resistance potential

  • Understanding resistance mechanisms that may emerge against LspA-targeting antibiotics

  • Designing combination therapies that target multiple essential bacterial pathways

The extensive conservation of active site residues in LspA suggests that resistance mutations that would impede antibiotic binding would likely also interfere with substrate binding and enzyme function . This characteristic makes LspA a particularly attractive target for addressing antibiotic resistance. Furthering our understanding of P. luteolum LspA specifically could contribute to a broader understanding of this enzyme family and its potential as an antibiotic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.