Recombinant Pelodictyon luteolum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, kindly specify your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
yidC; Plut_2129; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Chlorobium luteolum (strain DSM 273 / 2530) (Pelodictyon luteolum)
Target Names
yidC
Target Protein Sequence
MDRNSVTGLALIALIMIVWLQFMSPEKKPLQQVTDAGKARTEQVAAEINSDMQPAAVPAT EDSFGMFAPAASGTERLTVIDNDLFHAVVSSKGATLKSLVLKKHLDGNLKPFDLVSDAKN GALSMLFLTREGRRIDTRDLYFAGSSLDTLHTIKGKETYALSYRLALSPRQSIEVSYTFT GDSYRIGYDVKLTGLSGSLAGNEYQVQWDGGLPYTEKNRDDEARSAQASAYLGGSLVKLD AEKDGRSYREEQSGDARWVAVRNKYFIAALIPEDRTAGFYLDGQKERGNAYENYLASLKM EVPASEEVVDSRFSLYLGPLDYNTVKAQHADIEKIMDFGWDWLTRPFAEFVILPAFTWMN RFVSNYGLIIIIFAFLIKLVTYPLSTASTKSMKKMAALQPMLKELQDKYKDNPAKLQSEL GRIYKEAGVNPLGGCLPVVLQMPLLFAMFYVFRSSIQLRQHGFLWVKDLSVPDSILDFGF TIPMYGSHIALLPILMAVTVFLQQKITPTAQSNDQMKIMLYMFPAMMLLFFNNMPSGLAL YYLMFNVFSVAQQFYINSTSSAADLPQVSISAPSRPKKKKSGSGK
Uniprot No.

Target Background

Function
YidC, a membrane protein insertase, plays a crucial role in the insertion and proper folding of integral membrane proteins into the membrane. It participates in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, including at least some lipoproteins. Additionally, YidC assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structural organization of YidC membrane protein insertase?

YidC possesses a distinctive arrangement of five conserved transmembrane domains with a notable helical hairpin between transmembrane segments 2 (TM2) and TM3 on the cytoplasmic membrane surface. This structural organization is critical for its function in membrane protein insertion. The conserved third transmembrane segment (TM3) plays a particularly important role in substrate recognition and insertion . Molecular dynamics simulations have revealed that YidC induces thinning of the lipid bilayer by approximately 7-10 Å, resulting from hydrophobic mismatch between the transmembrane helices and membrane . This thinning is particularly pronounced near TM3 and TM5, regions that have been implicated in substrate binding through chemical cross-linking studies .

How does YidC function in membrane protein biogenesis across different species?

YidC is a universally conserved protein that functions as a membrane protein insertase across diverse species. In bacteria like Escherichia coli, YidC can operate either independently as a dedicated insertase for certain small membrane proteins or cooperatively with the SecY complex for Sec-dependent substrates . The presence of YidC homologues across all domains of life (Oxa1p in mitochondria and Alb3 in chloroplasts) underscores its fundamental importance in membrane protein biogenesis . While specific adaptations exist across species, the core mechanism involving substrate binding and membrane insertion appears conserved. The Pelodictyon luteolum YidC represents one such homolog that likely shares these functional characteristics while potentially exhibiting species-specific adaptations for its particular membrane environment .

How does YidC recognize and interact with its substrate proteins during membrane insertion?

YidC employs multiple domains to engage with substrate proteins in a coordinated process. Single-molecule force spectroscopy and fluorescence spectroscopy approaches have revealed that the cytoplasmic α-helical hairpin of YidC binds to substrate polypeptides within approximately 2 milliseconds, with high conformational variability and kinetic stability . The conserved third transmembrane segment (TM3) of YidC makes direct contact with the transmembrane domains of both Sec-dependent and Sec-independent substrates, indicating a generic recognition mechanism for insertion intermediates . Within approximately 52 milliseconds, YidC strengthens this binding and utilizes both its cytoplasmic α-helical hairpin domain and hydrophilic groove to facilitate the transfer of the substrate to a membrane-inserted, folded state . This inserted state exhibits low conformational variability, typical of properly folded transmembrane α-helical proteins.

What is the mechanism of YidC-induced membrane thinning and how does it facilitate protein insertion?

YidC induces significant thinning of the lipid bilayer (7-10 Å) due to hydrophobic mismatch between its transmembrane helices and the surrounding membrane . This thinning effect is particularly pronounced near TM3 and TM5, regions that have been experimentally confirmed through chemical cross-linking to interact directly with inserting substrates . The hydrophilic environment on the cytoplasmic side of the YidC transmembrane bundle extends into a hydrophobic cluster of aromatic residues toward the periplasmic side, creating a unique microenvironment . This architecture likely facilitates the transfer of polar termini and loops of substrate proteins across the hydrophobic core of the thinned lipid bilayer during translocation initiation, effectively lowering the energetic barrier for membrane insertion.

How does YidC prevent misfolding of membrane proteins during insertion?

YidC prevents misfolding of membrane proteins by stabilizing their unfolded state, from which structural segments can insert stepwise into the membrane until folding is complete . Single-molecule force spectroscopy studies with lactose permease (LacY) have demonstrated that YidC supports the folding of individual structural segments in a manner similar to that observed with native protein . Mechanical stability measurements showed that structural segments of native and YidC-assisted refolded LacY had similar force requirements for unfolding (native: 89.9 ± 29.4 pN; YidC-assisted refolding: 84.3 ± 25.3 pN), indicating proper structural formation . This stabilizing effect appears to be specific to YidC, as control experiments with lysozyme or BSA did not increase the probability of unfolded LacY polypeptide to insert and fold properly .

What is the nature of YidC's interaction with ribosomes during co-translational insertion?

YidC interacts directly with translating ribosomes at the ribosomal tunnel exit during co-translational membrane protein insertion . Cryo-electron microscopy reconstructions of translating YidC-ribosome complexes have revealed that a single copy of YidC engages with the ribosome specifically at the exit site of the ribosomal tunnel . This strategic positioning allows YidC to receive nascent membrane proteins as they emerge from the ribosome, facilitating their immediate insertion into the membrane at the YidC protein-lipid interface . This co-translational mode of action helps prevent aggregation or misfolding of hydrophobic transmembrane segments by minimizing their exposure to the aqueous environment.

How does YidC interact with the SRP targeting machinery?

YidC interacts efficiently with both Signal Recognition Particle (SRP) and its receptor FtsY, even at sub-stoichiometric concentrations . This interaction primarily involves the C1 loop of YidC, particularly around position D399, which has been identified through cross-linking studies . The YidC-SRP and YidC-FtsY interactions appear to be more stable and readily observable compared to YidC-SecYEG interactions, suggesting their functional importance in the targeting and delivery of nascent membrane proteins to YidC . This interaction network between YidC, SRP, and FtsY likely ensures the proper targeting of YidC-dependent substrates to the membrane for insertion, coordinating the translation, targeting, and insertion processes.

What are the optimal conditions for reconstituting functional Pelodictyon luteolum YidC into proteoliposomes?

While specific protocols for Pelodictyon luteolum YidC reconstitution are not detailed in the available literature, the approach would likely follow established methods for YidC reconstitution. Based on E. coli YidC reconstitution protocols, the process typically involves:

  • Purification of recombinant His-tagged YidC to homogeneity using affinity and ion exchange chromatography

  • Preparation of a solubilized dry film of bacterial lipids (E. coli lipids are commonly used)

  • Resuspension of lipids in buffer (e.g., 100 mM Na₂SO₄, Hepes pH 8.0)

  • Mixing purified YidC with resuspended lipids

  • Extrusion through membranes (e.g., 0.25 μm) to obtain proteoliposomes of uniform size

  • Collection of proteoliposomes by centrifugation and resuspension in desired buffer (e.g., 100 mM K₂SO₄)

The orientation of YidC in the proteoliposomes can be verified by protease protection assays, with trypsin digestion generating characteristic fragment patterns depending on YidC orientation .

What site-specific mutagenesis approaches are most effective for studying YidC function?

Site-specific mutagenesis of YidC has proven valuable for understanding structure-function relationships. A systematic approach involves:

  • Generation of cysteine-less YidC variants as negative controls and starting points for introducing single cysteine residues

  • Introduction of single cysteine residues at selected positions, particularly within transmembrane domains and connecting loops

  • Functional complementation assays to verify that the mutant YidC variants remain functional in vivo

  • Site-specific cross-linking studies to identify interaction partners and contact points

Table 1 shows examples of YidC variants with cysteine substitutions that have been used in structure-function studies:

NamePlasmidTM2 MutationTM3 Mutation
YidCpCL.YidC-StrepII-CBP--
C423ApCL.YidC-StrepII-CBP C423A-C423A
F356CpCL.YidC-StrepII-CBP C423A/F356CF356CC423A
S357CpCL.YidC-StrepII-CBP C423A/S357CS357CC423A
I358CpCL.YidC-StrepII-CBP C423A/I358CI358CC423A
F424CpCL.YidC-StrepII-CBP C423A/F424C-C423A/F424C
P425CpCL.YidC-StrepII-CBP C423A/P425C-C423A/P425C
L426CpCL.YidC-StrepII-CBP C423A/L426C-C423A/L426C
Q429CpCL.YidC-StrepII-CBP C423A/Q429C-C423A/Q429C
M430CpCL.YidC-StrepII-CBP C423A/M430C-C423A/M430C
P431CpCL.YidC-StrepII-CBP C423A/P431C-C423A/P431C

These variants can be used in cross-linking experiments to identify specific residues involved in substrate recognition and membrane insertion .

How can single-molecule approaches be applied to study YidC-mediated membrane protein insertion?

Single-molecule approaches have provided valuable insights into YidC function. Effective methodologies include:

  • Single-molecule force spectroscopy (SMFS): This technique can monitor the folding and unfolding of YidC substrates in real-time. SMFS has revealed that YidC-assisted membrane protein folding occurs in a stepwise and stochastic manner .

  • Single-molecule fluorescence spectroscopy: This approach can track the conformational changes and interactions between YidC and its substrates with millisecond temporal resolution .

  • Combined approach: Integration of force spectroscopy, fluorescence spectroscopy, and molecular dynamics simulations provides a comprehensive view of YidC function .

These approaches have elucidated the kinetics of YidC-substrate interactions, showing that YidC binds substrates within 2 milliseconds and facilitates their membrane insertion within 52 milliseconds . The single-molecule force measurements also revealed that YidC prevents membrane protein misfolding by stabilizing the unfolded state from which structural segments can insert stepwise into the membrane .

How can structural differences between YidC homologs be exploited for species-specific antimicrobial development?

The structural and functional differences between bacterial YidC and its eukaryotic homologs make it a potential target for antimicrobial development. Research approaches might include:

  • Comparative structural analysis of YidC from different bacterial species, including Pelodictyon luteolum, to identify conserved bacterial-specific features

  • Structure-based design of inhibitors targeting the substrate-binding pocket or the YidC-SecYEG interaction interface

  • High-throughput screening for compounds that specifically disrupt bacterial YidC function without affecting eukaryotic homologs

  • Development of compounds targeting the unique hydrophilic groove or the membrane-thinning mechanism of bacterial YidC

  • Validation of potential inhibitors in reconstituted systems and bacterial cultures

The essential nature of YidC for bacterial viability makes it an attractive antibiotic target, particularly for addressing antimicrobial resistance issues in current treatment options.

What are the challenges in resolving contradictory data regarding YidC-SecYEG interactions?

Several challenges exist in reconciling conflicting data on YidC-SecYEG interactions:

  • Stoichiometry imbalance: YidC is approximately five times more abundant than SecYEG in bacterial cells, complicating detection of interactions at native expression levels .

  • Interaction transience: The YidC-SecYEG interaction may be very transient or limited to a small SecYEG sub-population, requiring specialized techniques for detection .

  • Methodological limitations: Standard co-immunoprecipitation approaches may not capture weak or transient interactions effectively.

  • Expression system artifacts: Over-expression of either component may alter the natural interaction dynamics or create artificial associations.

To address these challenges, researchers have developed co-expression systems that allow simultaneous expression of YidC and SecYEG at controlled levels, enabling more reliable detection of interactions . Site-specific cross-linking approaches using incorporated pBpa have successfully identified interaction points between YidC and SecY . Future studies combining multiple complementary approaches, including cryo-electron microscopy of native complexes and time-resolved cross-linking, may help resolve remaining contradictions.

What experimental design would best elucidate the role of the lipid environment in YidC-mediated insertion?

An optimal experimental design to investigate the role of the lipid environment in YidC-mediated insertion would include:

  • Reconstitution experiments with defined lipid compositions:

    • Systematic variation of phospholipid head groups, acyl chain lengths, and saturation

    • Inclusion of bacterial-specific lipids like cardiolipin at varying concentrations

    • Comparison of native E. coli lipids with synthetic defined mixtures

  • Membrane thinning analysis:

    • Measurement of membrane thickness using small-angle X-ray scattering

    • Examination of hydrophobic mismatch effects with varying lipid compositions

    • Correlation of membrane thinning with insertion efficiency

  • Site-specific probes at the YidC-lipid interface:

    • Introduction of environmentally sensitive fluorophores at the protein-lipid boundary

    • EPR spectroscopy with spin-labeled lipids to monitor YidC-lipid interactions

    • Molecular dynamics simulations of YidC in various lipid environments

  • Functional assays with different lipid compositions:

    • Measurement of insertion efficiency for model substrates

    • Kinetic analysis of the insertion process under varying lipid conditions

    • Comparative analysis between Pelodictyon luteolum YidC and E. coli YidC

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.