Recombinant Pelodictyon luteolum UPF0761 membrane protein Plut_1323 (Plut_1323)

Shipped with Ice Packs
In Stock

Description

Physical and Chemical Properties

Table 1: Key Properties of Recombinant Pelodictyon luteolum UPF0761 Membrane Protein Plut_1323

PropertyValueSource
Length427 amino acids
Expression Region1-427 (full length)
Molecular FormLyophilized powder
Purity>90% (by SDS-PAGE)
UniProt IDQ3B399
Gene NamePlut_1323
SynonymsUPF0761 membrane protein Plut_1323
Strain SourceDSM 273

Expression and Recombinant Production

The recombinant form of Pelodictyon luteolum UPF0761 membrane protein Plut_1323 is typically produced using Escherichia coli as the expression system . This approach leverages E. coli's well-established protein production capabilities, which have been a cornerstone of recombinant protein technology for several decades .

Expression Systems and Methodology

The protein is expressed as a full-length construct (amino acids 1-427) with an N-terminal His-tag to facilitate purification . The His-tag provides an effective means for isolation using affinity chromatography, which is particularly valuable for membrane proteins that can be challenging to purify due to their hydrophobic nature.

Expression in E. coli offers several advantages for this particular membrane protein:

  1. High yield potential compared to other expression systems

  2. Well-established protocols for membrane protein expression

  3. Scalability for research and commercial applications

  4. Cost-effectiveness for protein production

While E. coli is the predominant expression system documented for this protein, alternative expression hosts may also be viable. These could potentially include yeast, baculovirus, or mammalian cell systems, which might offer advantages for proper folding and post-translational modifications if required for specific applications .

Reconstitution Protocol

For optimal results, the following reconstitution procedure is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being most common)

  4. Aliquot for long-term storage at -20°C/-80°C

This protocol minimizes protein degradation and ensures consistency across experiments, which is essential for reproducible research with membrane proteins.

Membrane Protein Biogenesis

Membrane proteins like Plut_1323 typically follow specific biogenesis pathways for proper insertion into cellular membranes. In prokaryotic systems such as Pelodictyon luteolum, this often involves the Signal Recognition Particle (SRP) dependent co-translational targeting pathway .

The pathway involves several key steps:

  1. Recognition of signal sequences by SRP54 protein

  2. GTP-dependent interaction with SRP receptor

  3. Delivery of ribosome-nascent chain complex to the membrane translocon

For prokaryotic membrane proteins, the SecY complex acts as the primary channel for insertion, utilizing a lateral gate opening to facilitate the integration of transmembrane domains into the lipid bilayer . Given the predicted transmembrane domains in Plut_1323, a similar mechanism likely facilitates its native membrane integration.

Lipid-Protein Interactions

The structure and function of membrane proteins are significantly influenced by their interactions with surrounding lipids. In some cases, specific lipid patches can stabilize membrane protein complexes, as observed in bacteriorhodopsin trimers . Whether Plut_1323 requires specific lipid environments for proper folding and function remains an open question for future research.

Research Applications and Significance

The recombinant production of Pelodictyon luteolum UPF0761 membrane protein Plut_1323 enables various research applications, from structural studies to functional characterization.

Potential Research Applications

Table 3: Research Applications for Recombinant Plut_1323 Protein

ApplicationMethodologyPotential Insights
Structural AnalysisX-ray crystallography, Cryo-EMDetermination of 3D structure and membrane topology
Functional CharacterizationReconstitution into liposomes, ElectrophysiologyIdentification of transport or signaling functions
Antibody DevelopmentImmunization, ELISATools for detection and localization studies
Protein-Protein InteractionPull-down assays, Cross-linkingIdentification of binding partners and complexes
Comparative BiologySequence and structural homology analysisEvolutionary relationships with other membrane proteins

The availability of high-purity recombinant Plut_1323 protein allows for detailed investigations that could potentially reveal its native function in Pelodictyon luteolum and contribute to broader understanding of membrane protein biology .

Relationship to Other UPF Family Proteins

As a member of the UPF0761 family, Plut_1323 belongs to a group of proteins whose functions remain largely uncharacterized. Comparative analysis with other UPF family members might provide insights into conserved structural features and potential functional roles. The UPF designation indicates that while the protein has been identified through genomic sequencing of Pelodictyon luteolum, its biological function has not yet been experimentally validated .

Analytical Methods for Characterization

Several analytical approaches can be employed to characterize the Recombinant Pelodictyon luteolum UPF0761 membrane protein Plut_1323, building upon established methods in membrane protein research.

Purity Assessment

SDS-PAGE analysis is the primary method for assessing protein purity, with recombinant Plut_1323 protein typically achieving greater than 90% purity . This high purity level is essential for downstream applications, particularly structural studies and functional assays where contaminants could interfere with results.

Future Research Directions

Research on the Recombinant Pelodictyon luteolum UPF0761 membrane protein Plut_1323 presents several promising avenues for future investigation.

Functional Characterization

As a membrane protein with uncharacterized function, determining the physiological role of Plut_1323 represents a significant research opportunity. Potential approaches include:

  1. Gene knockout studies in Pelodictyon luteolum to observe phenotypic effects

  2. Reconstitution into artificial membrane systems to assess transport or enzymatic activities

  3. Identification of interaction partners through co-immunoprecipitation or crosslinking studies

  4. Comparative genomics to identify functional patterns across related bacterial species

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Plut_1323; UPF0761 membrane protein Plut_1323
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
full length protein
Species
Chlorobium luteolum (strain DSM 273 / 2530) (Pelodictyon luteolum)
Target Names
Plut_1323
Target Protein Sequence
MAPGSNGIMDGMHRRIGEAGAFFRSFVPFFLQNVRHDRIFLSAGSLAFQTLLSIVPLLAV VLSILNVFAVFAPLQPYVEDFIVHNFVPGTGGMIREYFSGFIGNTFTMPIFGALFLFIVA LVLISTVDHTLNEIWEVHSPRKVLQGFTLYWTVLTLGPVLLATSLAASSFVWYTVFTEGP LLELKTRLLSLLPSTITVLALLLLYLLVPNRRVRFLHALSGALVATLLFEVSKRWFAFYV ANVATFEHIYGALSVIPMLFFWIYLGWVVVLTGAEIVYCLGARRLSGPAAPEFDPLRGVP LMLAVLRMVWRAGGEGVVLDMKKILREFHRENPSSLRKIVDILLECRFMHLTASGGMAAA SDLHVMTLYDLFIKLPPDFGAEDFGQAGPAWDGIELQGVRERLGACFEESMHVPLIQLMD GSNEGQV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.