Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit a (atpB) is a 33–340 amino acid polypeptide (molecular weight ~34 kDa) fused to an N-terminal His tag for purification . It is expressed in E. coli and purified to >90% homogeneity via SDS-PAGE . Key specifications include:

ParameterDetails
UniProt IDB4SH40
Gene NameatpB
SynonymsATP synthase F0 sector subunit a; F-ATPase subunit 6
Protein LengthFull-length mature protein (308 residues, positions 33–340)
TagHis-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C

Functional Role in ATP Synthase

ATP synthase couples proton gradient energy to ATP synthesis via rotational catalysis. Subunit a facilitates proton movement through half-channels, driving c-ring rotation. Key findings:

  • Proton translocation: Each 360° rotation of the c-ring synthesizes 3 ATP molecules .

  • Auto-inhibition: Bacterial ATP synthases (e.g., E. coli) are regulated by subunit ε, which obstructs rotation during ATP hydrolysis . Subunit a’s conformation influences this regulation .

  • Symmetry mismatch: The 10-subunit c-ring and 3-fold symmetric F1 sector create stepwise rotation (3–4 c-subunits per 120° F1 step) .

Research Applications

This recombinant protein is utilized in:

  • Structural studies: Cryo-EM and crystallography to resolve rotary mechanisms .

  • Mutagenesis assays: Probing residues involved in proton transport (e.g., Arg-182, Lys-155) .

  • Drug discovery: Screening inhibitors targeting bacterial ATP synthase (e.g., antimicrobial peptides) .

  • Enzyme reconstitution: Incorporation into proteoliposomes to study ATP synthesis/hydrolysis .

Research Significance

Studies of recombinant atpB enhance understanding of ATP synthase evolution, particularly in green sulfur bacteria (Chlorobiaceae) like P. phaeoclathratiforme, which thrive in low-light aquatic environments . Its structural simplicity compared to mitochondrial ATP synthase makes it a model for dissecting rotary mechanics and developing bacterial-specific therapeutics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks and we will fulfill them as requested.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
atpB; Ppha_2885; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-340
Protein Length
Full Length of Mature Protein
Species
Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Target Names
atpB
Target Protein Sequence
LTEQASTPPHDSVASVSAPTAEAAVAAHAHGEEKAGDVIMHHILDNDVFSFEPFGEVHLP KIPPIAGVDISITKHVVMLWVVSAILLILFSLVGSKYKKMTARQAPTGLVNAMEALVEFI RIDVAKANIGVGYEKYLNYLLTVFFFVLLCNLLGLVPYGATATGNINVTLTLATFTFFIT QVAALKAHGIKGYLAHLTGGTHPALWIIMIPIEFIGLFTKPVALTIRLFANMTAGHIVIL SLIFISFILQSYIVAVVMSVPFSIFIYLLELFVAFLQAFIFTMLSSLFIGLASAHEGHEE HEAGVAHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pelodictyon phaeoclathratiforme and why is it significant in microbiology?

Pelodictyon phaeoclathratiforme is a brown-colored member of the Chlorobiaceae family (green sulfur bacteria) that forms distinctive net-like colonies. It was first isolated from the monimolimnion of Buchensee near Radolfzell in the Lake Constance region of Germany. Single cells of this organism are rod-shaped, nonmotile, and contain gas vacuoles. The formation of net-like colonies occurs through ternary fission of cells, which is a characteristic feature of this organism .

P. phaeoclathratiforme is significant in microbiology for several reasons. Unlike its green-colored counterpart (P. clathratiforme), it contains bacteriochlorophyll e and the carotenoids isorenieratene and β-isorenieratene as its major photosynthetic pigments. It utilizes sulfide, sulfur, and thiosulfate as electron donors during anaerobic phototrophic growth. The bacterium can use carbon dioxide as a carbon source, and can also use acetate and propionate under mixotrophic conditions in the light. As with other green sulfur bacteria, it is strictly anaerobic and obligately phototrophic .

The organism's unique characteristics, including its gas vacuoles, net-like colony formation, and its DNA composition (47.9 mol% G+C content), make it an important model organism for studying bacterial photosynthesis and energy metabolism in anoxygenic phototrophic bacteria.

What is the structure and function of ATP synthase subunit a (atpB) in bacteria?

ATP synthase subunit a, encoded by the atpB gene in P. phaeoclathratiforme, is a critical component of the F0 sector of the ATP synthase complex. The F0 sector is the membrane-embedded portion of the ATP synthase that functions as a proton channel. In well-studied bacteria like Escherichia coli, the F0 complex consists of subunits a, b, and c, with a stoichiometry of 1:2:12 .

Structurally, the atpB protein in P. phaeoclathratiforme consists of 308 amino acids (residues 33-340 of the full-length protein). The protein contains several transmembrane domains that anchor it in the membrane and facilitate its role in proton translocation. The amino acid sequence includes highly conserved regions that are crucial for proton channeling and interaction with other ATP synthase subunits .

Functionally, subunit a forms part of the proton channel through the membrane and works in concert with the c-ring to couple proton movement to mechanical rotation. This rotation drives conformational changes in the F1 sector, which ultimately leads to ATP synthesis. The specific arrangement of charged amino acids within subunit a creates a pathway for protons to enter from one side of the membrane and exit on the other, thereby generating the rotational force necessary for ATP synthesis .

How is recombinant P. phaeoclathratiforme ATP synthase subunit a (atpB) typically prepared for research use?

Recombinant P. phaeoclathratiforme ATP synthase subunit a (atpB) is prepared using molecular cloning and protein expression techniques. The process typically involves the following steps:

  • Gene isolation: The atpB gene (locus name Ppha_2885) is isolated from P. phaeoclathratiforme (strain DSM 5477 / BU-1) genomic DNA .

  • Vector construction: The isolated gene is inserted into an appropriate expression vector with a suitable tag for purification. The tag type is often determined during the production process to optimize protein yield and stability .

  • Expression: The recombinant vector is transformed into a host expression system (typically E. coli) for protein production.

  • Purification: The expressed protein is purified using affinity chromatography based on the attached tag, followed by additional purification steps if needed.

  • Storage: The purified protein is stored in a Tris-based buffer with 50% glycerol, which helps maintain protein stability. For optimal preservation, the protein should be stored at -20°C, or at -80°C for extended storage .

The commercially available recombinant protein typically comes as a 50 μg preparation, with the full-length sequence expressed from amino acids 33-340. It's important to note that repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week to maintain activity .

What are the optimal conditions for studying P. phaeoclathratiforme atpB function in vitro?

When studying P. phaeoclathratiforme atpB function in vitro, researchers should consider several critical parameters to ensure optimal experimental conditions:

Buffer Composition:

  • Tris-based buffers with pH 7.5-8.0 are generally recommended for ATP synthase studies

  • 50% glycerol should be included for protein stability during storage

  • The buffer should be optimized specifically for atpB to maintain its native conformation

Membrane Reconstitution:
For functional studies of membrane proteins like atpB, reconstitution into artificial membrane systems is essential:

  • Phospholipid vesicles (liposomes) provide an environment that mimics the native membrane

  • Cholate-containing buffers have been used successfully for the reconstitution of related ATP synthase subunits

  • After reconstitution, circular dichroism spectroscopy can confirm proper folding of the protein (related ATP synthase subunits typically show approximately 80% alpha-helical conformation)

Interaction Studies:

  • For investigating interactions with other ATP synthase subunits, a co-reconstitution approach may be used

  • His-tagged versions of the protein can facilitate interaction studies through pull-down assays

  • Stable subcomplexes (like ab2 in related systems) can be formed and studied under controlled conditions

Proton Translocation Assays:

  • pH-sensitive fluorescent dyes can be used to monitor proton translocation activity

  • Control experiments should include measurements with and without other F0 subunits

  • Comparison with wild-type F0 complex activities provides important reference points

What methods can be used to study the interaction between atpB and other ATP synthase subunits?

Several sophisticated methodological approaches can be employed to investigate the interactions between atpB and other ATP synthase subunits:

Co-immunoprecipitation and Pull-down Assays:

  • His-tagged atpB can be used as bait to identify interacting partners

  • Antibody-based pull-downs can isolate native protein complexes

  • Western blotting with specific antibodies can confirm the presence of interacting subunits

Reconstitution Studies:

  • Purified atpB can be combined with other purified subunits (particularly b and c) to reconstitute functional subcomplexes

  • Activity assays (such as proton translocation) can confirm successful reconstitution

  • Comparison with wild-type complexes provides reference points for functional assessment

Cross-linking Mass Spectrometry:

  • Chemical cross-linkers can capture transient interactions between subunits

  • Mass spectrometry analysis of cross-linked peptides can identify specific contact points

  • This approach provides detailed information about the spatial arrangement of interacting regions

Epitope Mapping:

  • Monoclonal antibodies against specific subunits can be used to identify exposed regions

  • Overlapping synthetic peptides can help map precise binding sites

  • For example, in related systems, epitopes have been mapped to hydrophilic loop regions

Subcomplex Isolation:

  • Stable subcomplexes (such as ab2) can be isolated and characterized

  • The purification of such subcomplexes suggests direct interactions between the component subunits

  • Addition of other subunits to reconstitute larger complexes can provide insights into assembly pathways

Site-directed Mutagenesis:

  • Targeted mutations in predicted interaction sites can disrupt or alter subunit interactions

  • Functional assays following mutation can reveal the importance of specific residues

  • Compensatory mutations in interacting subunits can restore function, confirming specific interaction sites

What are the challenges in working with membrane proteins like ATP synthase subunit a and how can they be overcome?

Working with membrane proteins like ATP synthase subunit a presents several significant challenges due to their hydrophobic nature and structural complexity. Here are the major challenges and strategies to overcome them:

Challenges in Expression and Purification:

  • Low expression levels - Membrane proteins often express poorly in heterologous systems

  • Protein toxicity to host cells during overexpression

  • Protein instability outside the membrane environment

  • Aggregation during purification steps

Solutions:

  • Use specialized expression systems designed for membrane proteins

  • Express as fusion proteins with solubility-enhancing tags

  • Employ cell-free expression systems when cellular toxicity is an issue

  • Use mild detergents or lipid nanodiscs to maintain native-like environments

Challenges in Functional Reconstitution:

  • Loss of native conformation during purification

  • Incorrect orientation in artificial membranes

  • Absence of essential lipids or interacting proteins

Solutions:

  • Reconstitute in liposomes with lipid compositions that mimic native membranes

  • Use cholate-containing buffers for renaturation of purified protein

  • Verify functional activity through proton translocation assays

  • Confirm proper folding using circular dichroism spectroscopy

Challenges in Structural Studies:

  • Difficulty in crystallization for X-ray crystallography

  • Size limitations for NMR studies

  • Conformational heterogeneity

Solutions:

  • Use advanced structural biology techniques like cryo-electron microscopy

  • Stabilize protein with antibody fragments or nanobodies

  • Study stable subcomplexes (like ab2) as building blocks toward understanding the whole complex

Challenges in Genetic Manipulation:

  • Essential nature of ATP synthase genes makes knockout studies difficult

  • Pleiotropy of mutations affecting multiple cellular processes

Solutions:

  • Combine gene transfer agent transduction with conjugation methods

  • Use conditional expression systems

  • Create strains carrying mutations in indispensable genes using specialized techniques as demonstrated with related ATP synthase operons

How can recombinant P. phaeoclathratiforme atpB be used in structural and functional studies?

Recombinant P. phaeoclathratiforme atpB provides researchers with a powerful tool for various structural and functional studies:

Structural Studies:

  • Crystallography: Purified recombinant atpB can be used in crystallization trials for X-ray crystallography, potentially yielding high-resolution structural information.

  • Cryo-EM Analysis: The protein can be incorporated into larger ATP synthase subcomplexes for cryo-electron microscopy studies.

  • NMR Studies: Specific domains or peptides derived from atpB can be analyzed using nuclear magnetic resonance to determine local structures and dynamics.

Functional Studies:

  • Reconstitution Experiments: The purified protein can be reconstituted with other ATP synthase subunits to study complex assembly and function.

  • Proton Translocation Assays: When properly incorporated into liposomes, the protein can be used to measure proton translocation activity.

  • Site-Directed Mutagenesis: The recombinant protein serves as a template for creating mutants to identify critical residues for function.

Interaction Studies:

  • Protein-Protein Interaction Mapping: Using techniques like pull-down assays, cross-linking, or surface plasmon resonance to study interactions with other ATP synthase subunits.

  • Antibody Production: The recombinant protein can be used to generate antibodies for immunolocalization or immunoprecipitation studies .

Comparative Studies:

  • Evolutionary Analysis: Comparing the structure and function of P. phaeoclathratiforme atpB with homologs from other species can provide insights into evolutionary adaptations.

  • Bioenergetic Differences: Investigating how the unique features of this protein contribute to the specific bioenergetic properties of P. phaeoclathratiforme.

What site-directed mutagenesis approaches would be most effective for studying functional domains of bacterial ATP synthase subunit a?

Site-directed mutagenesis represents a powerful approach for identifying critical functional domains within the bacterial ATP synthase subunit a. Based on existing knowledge of ATP synthase structure and function, the following systematic mutagenesis strategies would be most effective:

Targeting Conserved Charged Residues:

  • Create alanine substitutions of conserved arginine, lysine, aspartic acid, and glutamic acid residues

  • Focus particularly on residues that are likely involved in proton translocation

  • Create charge-swap mutations (e.g., positive to negative) to test the importance of charge rather than just the presence of a charged residue

Transmembrane Domain Mutations:

  • Target residues within predicted transmembrane helices, especially those that might line the proton channel

  • Substitute small hydrophobic residues with larger ones to test spatial constraints

  • Replace key hydrophobic residues with polar ones to disrupt membrane association

Interface Residues:

  • Identify and mutate residues likely to interact with the c-ring or other F0 subunits

  • Create mutations that might disrupt protein-protein interactions

  • Design compensatory mutations in interacting subunits to restore function

Progressive Truncation Analysis:

  • Generate a series of C-terminal and N-terminal truncations to identify essential regions

  • Create internal deletions of specific domains to test their functional importance

  • Follow up with point mutations within regions identified as critical through truncation analysis

Methodology Considerations:

  • Use a complementation system where the mutant atpB can be expressed in a background where the endogenous gene is inactivated or conditionally expressed

  • Combine gene transfer agent transduction with conjugation methods to overcome challenges with essential genes

  • Assess the effects of mutations using functional assays such as ATP synthesis/hydrolysis, proton translocation, and complex assembly

A systematic application of these approaches would provide comprehensive insights into structure-function relationships within the ATP synthase subunit a from P. phaeoclathratiforme.

How does P. phaeoclathratiforme ATP synthase compare to ATP synthases from other bacterial species?

The ATP synthase from P. phaeoclathratiforme shows both similarities and important differences when compared to ATP synthases from other bacterial species:

Structural Organization:

  • Like other bacterial ATP synthases, P. phaeoclathratiforme ATP synthase consists of F1 and F0 sectors

  • The F1 sector contains the catalytic sites for ATP synthesis/hydrolysis

  • The F0 sector forms the membrane-embedded proton channel

Genetic Organization:

  • In some bacteria like Rhodobacter capsulatus, the genes coding for the F1 sector (atpHAGDC) are separated from those coding for the F0 sector

  • This separated genetic organization is also observed in Rhodospirillum rubrum and Rhodopseudomonas blastica, suggesting a similar arrangement might exist in P. phaeoclathratiforme

Subunit Composition:

  • While the basic subunit composition is conserved across bacteria, specific adaptations may exist in P. phaeoclathratiforme

  • In E. coli, the F0 sector consists of subunits a, b, and c in a stoichiometry of 1:2:12

  • The protein-protein interactions, particularly the formation of stable subcomplexes like ab2, appear to be conserved features of bacterial ATP synthases

Functional Properties:

  • As a photosynthetic bacterium, P. phaeoclathratiforme ATP synthase would be adapted to function in conjunction with the photosynthetic apparatus

  • This could result in specific regulatory mechanisms or structural adaptations not present in non-photosynthetic bacteria

  • The proton motive force that drives ATP synthesis in P. phaeoclathratiforme is generated through light-dependent processes, unlike respiratory bacteria

Evolutionary Context:

  • P. phaeoclathratiforme belongs to the green sulfur bacteria (Chlorobiaceae), a distinct phylogenetic group

  • Its ATP synthase likely reflects adaptations specific to its ecological niche as an anaerobic, phototrophic organism that forms net-like colonies

  • The G+C content of P. phaeoclathratiforme DNA (47.9 mol%) may influence codon usage in the atpB gene, potentially affecting heterologous expression strategies

What research techniques are available for analyzing the proton translocation mechanism in ATP synthase subunit a?

The analysis of proton translocation mechanisms in ATP synthase subunit a requires sophisticated techniques that can detect subtle changes in protein function and structure. The following methodological approaches are particularly valuable:

pH-Sensitive Fluorescent Probes:

  • Fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine can be entrapped in proteoliposomes

  • Changes in fluorescence intensity correlate with proton movement across the membrane

  • This allows real-time monitoring of proton translocation activity

  • Comparison between wild-type and mutant proteins can identify residues critical for proton movement

Electrophysiological Methods:

  • Patch-clamp techniques can measure ion currents across membranes

  • Reconstitution of purified subunit a into planar lipid bilayers allows direct measurement of proton conductance

  • These approaches can provide detailed information about the kinetics and voltage dependence of proton translocation

Hydrogen/Deuterium Exchange Mass Spectrometry:

  • This technique can identify regions of the protein that are accessible to solvent

  • Changes in deuterium incorporation patterns upon mutation or inhibitor binding can reveal conformational changes associated with proton translocation

  • The method provides structural information under physiologically relevant conditions

Cysteine Scanning Mutagenesis:

  • Systematic replacement of residues with cysteine followed by chemical modification

  • Thiol-reactive compounds can be used to probe accessibility of specific residues

  • The effects of modification on proton translocation activity can identify residues lining the proton path

Computational Molecular Dynamics:

  • Molecular dynamics simulations can model proton movement through the protein

  • These models can be validated experimentally through targeted mutagenesis

  • Quantum mechanics/molecular mechanics (QM/MM) approaches can specifically address proton transfer events

Specific Inhibitor Studies:

  • Compounds like DCCD (dicyclohexylcarbodiimide) that specifically interact with proton-translocating apparatus

  • Resistance mutations can identify residues involved in inhibitor binding and proton translocation

  • Cross-linking studies with photoactivatable inhibitor analogs can identify binding sites

When applied systematically, these techniques can provide complementary information about the molecular details of proton translocation through ATP synthase subunit a.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.