Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pelodictyon phaeoclathratiforme ATP Synthase Subunit b (atpF)

Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF) is a component of the ATP synthase complex found in the bacterium Pelodictyon phaeoclathratiforme. ATP synthase, also known as F-ATPase, is an enzyme that catalyzes the synthesis of adenosine triphosphate (ATP), a crucial energy currency in living cells . The bacterial ATP synthase structure includes the F₀ and F₁ domains; subunit b is part of the F₀ complex, which is embedded in the cell membrane and responsible for proton translocation . Recombinant ATP synthase subunit b (atpF) refers to the protein that has been produced using recombinant DNA technology . This involves introducing the gene encoding atpF into a host organism, such as E. coli, which then expresses the protein . The recombinant protein can then be isolated and used for various research purposes, including structural and functional studies .

Gene Information and Characteristics

CategoryDescription
Gene NameatpB
SynonymsatpB; Ppha_2885; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
UniProt IDB4SH40
SpeciesPelodictyon phaeoclathratiforme
SourceE. coli
TagHis
Protein LengthFull Length of Mature Protein (33-340)
AA SequenceLTEQASTPPHDSVASVSAPTAEAAVAAHAHGEEKAGDVIMHHILDNDVFSFEPFGEVHLP KIPPIAGVDISITKHVVMLWVVSAILLILFSLVGSKYKKMTARQAPTGLVNAMEALVEFI RIDVAKANIGVGYEKYLNYLLTVFFFVLLCNLLGLVPYGATATGNINVTLTLATFTFFIT QVAALKAHGIKGYLAHLTGGTHPALWIIMIPIEFIGLFTKPVALTIRLFANMTAGHIVIL SLIFISFILQSYIVAVVMSVPFSIFIYLLELFVAFLQAFIFTMLSSLFIGLASAHEGHEE HEAGVAHH
PurityGreater than 90% as determined by SDS-PAGE

Role and Function of Subunit b in ATP Synthase

Subunit b is a crucial component of the F₀ complex of ATP synthase, which is embedded in the cell membrane . The F₀ complex is responsible for translocating protons across the membrane, using the electrochemical gradient to drive ATP synthesis . Subunit b plays a key role in connecting the F₀ complex to the F₁ complex, which is the catalytic portion of ATP synthase . It forms a stalk-like structure that stabilizes the entire enzyme complex . The N-terminal α-helix of subunit b interacts with transmembrane α-helices of subunit a, and mutations in this region can be detrimental to the assembly and activity of the complex .

Experimental and Research Findings

Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF) is used in various experimental studies to elucidate the structure, function, and regulation of ATP synthase .

  • Structural Studies X-ray crystallography and cryo-electron microscopy are employed to determine the atomic structure of ATP synthase, including subunit b . These structures provide insights into the interactions between subunits and the conformational changes that occur during ATP synthesis .

  • Functional Studies Recombinant subunit b is used to investigate its role in proton translocation and ATP synthesis . Mutagenesis studies, where specific amino acids are altered, help to identify critical residues involved in these processes .

  • Regulation of ATP Hydrolysis Subunit ε plays a role in regulating ATP synthase activity by affecting the efficiency of coupling, influencing the catalytic pathway, and selectively inhibiting ATP hydrolysis activity . Conformational transitions in the α-helical C-terminal domain of subunit ε, in response to membrane energization, changes in ATP/ADP ratio, or the addition of inhibitors, mediate this regulation .

Biotechnological Applications

  • Antimicrobial Development ATP synthase is an essential enzyme in bacteria, making it a potential target for developing new antibacterial agents. Inhibitors of ATP synthase could disrupt ATP production, leading to cell death .

  • Structural Insights Structural studies of bacterial ATP synthase have revealed unique features, such as the arrangement of subunit b, which could be exploited for drug design .

  • Potential Drug Targets Research has explored compounds that target metabolic enzymes in pathogens . While not directly targeting ATP synthase subunit b, these studies demonstrate the potential for developing inhibitors that disrupt essential metabolic pathways in pathogenic organisms .

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock. If you require a specific format, please specify this in your order.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, with additional charges applying. Please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Ppha_2883; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Target Names
atpF
Target Protein Sequence
MLTSGIILLAGSLLSPNPGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDR AHSAKEESEAILRKNRELLAKADAESDKIIREGKDYADKLRADITEKAQSEAKKMIATAK DEIEQEKRRALDVLRNEVADLAVKGAEKIIKTTLDADMQKKIVDSMIQDLSTKRN
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk which connects F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Pelodictyon phaeoclathratiforme ATP synthase subunit b (atpF)?

ATP synthase subunit b (atpF) from Pelodictyon phaeoclathratiforme is a component of the F0 sector of ATP synthase. According to product information, it is a 171-amino acid protein with the sequence: mLTSGIILLAGSLLSPNPGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDRAHSAKEESEAILRKNRELLAKADAESDKIIREGKDYADKLRADITEKAQSEAKKMIATAKDEIEQEKRRALDVLRNEVADLAVKGAEKIIKTTLDADMQKKIVDSMIQDLSTKRN . The protein is identified in UniProt with the accession number B4SH38 and is classified as part of the ATP synthase F0 sector, which is essential for ATP synthesis in bacteria.

What is the functional role of ATP synthase subunit b in bacterial systems?

ATP synthase subunit b serves several critical functions in bacterial ATP synthases:

  • It forms part of the membrane-embedded F0 sector that facilitates ion translocation across the membrane

  • It provides structural support connecting the F0 sector to the catalytic F1 sector

  • It contributes to the stability of the ATP synthase complex during the rotational catalysis process

  • It may participate in ion transport coupling mechanisms that drive ATP synthesis

In many ATP synthases, the b subunit works in conjunction with the c-ring, which contains ion-binding sites crucial for energy transduction during ATP synthesis .

What are the optimal storage conditions for recombinant atpF?

For optimal stability and activity preservation, recombinant P. phaeoclathratiforme ATP synthase subunit b should be stored according to these guidelines:

  • Primary storage: -20°C in Tris-based buffer with 50% glycerol

  • Extended storage: -20°C or -80°C

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freezing and thawing cycles as this can compromise protein integrity

The high glycerol content (50%) in the storage buffer helps prevent freeze-thaw damage by reducing ice crystal formation that could denature the protein.

How should experiments be designed to study ATP synthase activity?

A robust experimental design for studying ATP synthase activity should follow these methodological steps:

  • Define variables with precision:

    • Independent variables: ion gradients (ΔpNa/ΔpH), electrical potential (Δψ), inhibitor concentrations

    • Dependent variables: ATP synthesis/hydrolysis rates

    • Control variables: temperature, buffer composition, pH, protein concentration

  • Establish a hypothesis that predicts a specific relationship between variables, such as "ATP synthesis rate increases with increasing sodium ion gradient in a Na+-dependent ATP synthase" .

  • Design treatments that systematically manipulate independent variables:

    • Create defined ion gradients using controlled buffer compositions

    • Generate electrical potentials using ionophores like valinomycin

    • Test inhibitors such as DCCD at varying concentrations

  • Include appropriate controls:

    • Negative controls (e.g., omitting ADP, adding protonophores like TCS)

    • System verification controls (e.g., ATP hydrolysis activity measurements)

    • Inhibitor controls to confirm specificity of activity

  • Measurement approach:

    • Time-course measurements to determine initial rates

    • Multiple replicates to enable statistical analysis

    • Appropriate detection methods (e.g., luciferase assay for ATP production)

This systematic approach helps establish causal relationships and minimizes experimental bias .

How can recombinant atpF be incorporated into functional ATP synthase complexes for experiments?

To utilize recombinant atpF in functional studies, researchers should follow these methodological steps:

  • Reconstitution into liposomes:

    • Purify all necessary ATP synthase components

    • Prepare liposomes with defined lipid composition

    • Incorporate the purified ATP synthase containing recombinant atpF

    • Verify successful incorporation by measuring ATP hydrolysis activity

  • Set up conditions for ATP synthesis:

    • Generate ion gradients across the liposome membrane (e.g., ΔpNa of 70 mV)

    • Create electrical potential (e.g., K+ diffusion potential of 160 mV using valinomycin)

    • Add ADP and inorganic phosphate as substrates

    • Monitor ATP production over time

  • Verify functionality through:

    • Confirming Na+ dependence by varying Na+ concentrations

    • Testing inhibitor sensitivity (e.g., DCCD inhibition and rescue with Na+)

    • Measuring response to different driving forces

In published studies, reconstituted ATP synthases demonstrated linear ATP synthesis rates for approximately 2 minutes under appropriate conditions, with rates of about 99.2 nmol·min⁻¹·mg protein⁻¹ .

What methods can be used to verify the integrity and functionality of recombinant atpF?

A comprehensive quality assessment approach should include:

  • Structural integrity verification:

    • SDS-PAGE to confirm molecular weight

    • Mass spectrometry for exact mass determination

    • Circular dichroism to assess secondary structure

  • Functional assessment:

    • ATP hydrolysis activity when incorporated into ATP synthase complex

      • Functional ATP synthases typically show activity in the range of 0.63 ± 0.11 U/mg

    • ATP synthesis capacity in response to ion gradients

    • Na+/H+ binding assays if applicable

  • Integration tests:

    • Co-purification with other ATP synthase subunits

    • Native PAGE to assess complex formation

    • Cross-linking studies to confirm proper assembly

  • Specificity verification:

    • Na+ dependence tests showing half-maximal activity around 0.57 mM Na+

    • DCCD inhibition studies to confirm specific binding to the c-ring

How do V-type c subunits affect ATP synthesis capabilities?

Recent research has revealed surprising findings about ATP synthases containing V-type c subunits:

  • Contrary to previous assumptions, ATP synthases with V-type c subunits (as found in many anaerobic archaea) can synthesize ATP at physiologically relevant driving forces of 90-150 mV .

  • Comparative analysis shows distinctive properties:

ATP Synthase TypeThreshold for ATP SynthesisCan Use Δψ AloneCan Use ΔpIon Alone
A₁A₀ with V-type c (E. callanderi)87 mVYesYes
F₁F₀ with hybrid rotor (A. woodii)90 mVYes (lower efficiency)No
F₁F₀ (P. modestum)120 mVNoNo
F₁F₀ (E. coli)150 mVNoNo
  • The ability to operate at lower driving forces (87-90 mV vs. 120-150 mV) represents an adaptation particularly beneficial "for life near the thermodynamic limit of ATP synthesis" .

  • The evolutionary significance is substantial, challenging the previously held view that V-type c subunits were primarily associated with ATP hydrolysis rather than synthesis .

What driving forces are required for ATP synthesis by different ATP synthase types?

Different ATP synthases exhibit varying requirements for the driving forces that power ATP synthesis:

  • Total driving force components:

    • Electrical field (Δψ)

    • Ion gradient (ΔpH or ΔpNa)

    • Combined as: Δμᵢₒₙ/F = Δψ - (2.3·RT/F)·ΔpIon

  • ATP synthase-specific requirements:

    • E. callanderi A₁A₀ ATP synthase: Can use either ΔpNa or Δψ individually

    • E. coli and P. modestum F₁F₀ ATP synthases: Require both ΔpH/ΔpNa and Δψ together

    • A. woodii Na+ F₁F₀ ATP synthase: Can use Δψ alone (with lower efficiency) but not ΔpNa alone

  • Experimental methods to test driving force requirements:

    • Generating defined Δψ with K+ diffusion potentials (using valinomycin)

    • Creating ΔpNa with controlled internal/external Na+ concentrations

    • Testing ATP synthesis under various combinations of these forces

    • Using ionophores (TCS, ETH2120) to selectively dissipate specific components

Understanding these requirements is crucial for experimental design when studying novel ATP synthases like those potentially containing P. phaeoclathratiforme atpF.

How can researchers control for extraneous variables in ATP synthase experiments?

Controlling extraneous variables is critical for reliable ATP synthase research:

  • Ion gradient control:

    • Precisely define internal and external buffer compositions

    • Monitor actual ion concentrations before and during experiments

    • Include ionophore controls (e.g., TCS for proton gradients, ETH2120 for Na+ gradients)

  • Experimental verification controls:

    • Test ADP dependence by omitting ADP (should result in no ATP synthesis)

    • Use ionophores to collapse gradients (should abolish ATP synthesis)

    • Include substrate controls to verify enzymatic activity

  • Enzyme quality control:

    • Verify ATP hydrolysis activity prior to synthesis experiments

    • Confirm Na+/H+ dependence through titration studies

    • Assess inhibitor sensitivity patterns

  • Data collection and analysis:

    • Measure initial rates within linear range (typically first 1-2 minutes)

    • Perform multiple replicates for statistical validity

    • Apply appropriate statistical tests to determine significance

  • Environmental factors:

    • Maintain constant temperature throughout experiments

    • Control light exposure for photosensitive components

    • Minimize contamination with ATP or ATPase activities

What insights can comparative studies of ATP synthases provide for understanding bacterial energy metabolism?

Comparative analysis of ATP synthases from different bacterial species offers valuable insights:

  • Evolutionary adaptations:

    • Lower threshold values in ATP synthases with V-type c subunits suggest adaptation to energy-limited environments

    • Ion specificity (Na+ vs. H+) reflects ecological niche adaptations

    • Varying driving force requirements indicate evolutionary specialization

  • Energetic efficiency:

    • A₁A₀ ATP synthases with V-type c subunits can synthesize ATP at driving forces as low as 87 mV

    • This efficiency is crucial for "life near the thermodynamic limit of ATP synthesis"

    • Flexibility in using either Δψ or ΔpNa provides metabolic advantages in fluctuating environments

  • Methodology for comparative studies:

    • Standardized reconstitution in liposomes enables direct comparison

    • Systematic testing of driving force requirements reveals functional differences

    • Analysis of ATP synthesis rates and threshold values provides quantitative comparison metrics

  • Implications for understanding P. phaeoclathratiforme energetics:

    • Characterization of its ATP synthase would reveal adaptation to its specific ecological niche

    • Comparison with other green sulfur bacteria could illuminate evolutionary patterns

    • Insights into energy conservation mechanisms in anaerobic phototrophs

How can researchers ensure data integrity in ATP synthase experiments?

In light of recent concerns about data integrity in biochemical research , researchers studying ATP synthases should implement these best practices:

  • Experimental controls and validation:

    • Include multiple positive and negative controls in each experiment

    • Verify findings with complementary methodological approaches

    • Document raw data thoroughly with timestamps and experimental conditions

  • Image and data processing:

    • Maintain original, unmodified images and data files

    • Document all processing steps and parameters

    • Avoid inappropriate duplication of image elements

  • Statistical approaches:

    • Pre-register experimental designs when possible

    • Report all attempts and replicates, not just successful ones

    • Perform appropriate statistical tests and report p-values accurately

  • Peer review and collaboration:

    • Have team members independently verify critical results

    • Maintain detailed laboratory notebooks accessible to team members

    • Implement quality control checkpoints throughout research projects

  • Reporting guidelines:

    • Follow field-specific reporting standards

    • Include detailed methods sections that enable reproduction

    • Make original data available through appropriate repositories

What methodological challenges are specific to studying ATP synthases from anaerobic bacteria?

Working with ATP synthases from anaerobic organisms like P. phaeoclathratiforme presents unique methodological challenges:

  • Protein production and handling:

    • Expression in aerobic systems may require optimization for proper folding

    • Protective measures against oxidative damage during purification

    • Verification of structural integrity after purification

  • Activity measurements:

    • Maintaining anaerobic conditions during functional assays

    • Distinguishing between Na+ and H+ coupling mechanisms

    • Accounting for lower activity rates compared to aerobic systems

  • Reconstitution considerations:

    • Selection of appropriate lipid compositions mimicking native membranes

    • Verification of correct orientation in liposomes

    • Achieving sufficient incorporation rates for detection of activity

  • Experimental design:

    • Establishing physiologically relevant ion gradients and electrical potentials

    • Developing sensitive detection methods for low ATP synthesis rates

    • Implementing appropriate controls specific to anaerobic systems

How might studies of P. phaeoclathratiforme atpF contribute to understanding bacterial adaptation to extreme environments?

Research on P. phaeoclathratiforme ATP synthase could illuminate adaptation mechanisms through:

  • Comparative genomics and structure-function analysis:

    • Identifying unique sequence features related to environmental adaptation

    • Correlating structural elements with functional properties

    • Mapping evolutionary relationships with other bacterial ATP synthases

  • Bioenergetic characterization:

    • Determining threshold driving forces for ATP synthesis

    • Analyzing ion specificity and coupling mechanisms

    • Measuring ATP synthesis efficiency under varying conditions

  • Ecological context integration:

    • Relating ATP synthase properties to P. phaeoclathratiforme's sulfide-rich, anoxic lake habitat

    • Comparing with other green sulfur bacteria from different environments

    • Investigating energy conservation strategies in low-light, anaerobic conditions

  • Experimental approaches:

    • Heterologous expression and reconstitution studies

    • Site-directed mutagenesis to identify key functional residues

    • Cryo-EM structural studies to resolve ATP synthase architecture

What innovations in experimental design could advance ATP synthase research?

Advancing ATP synthase research requires methodological innovations:

  • High-throughput approaches:

    • Miniaturized systems for parallel testing of multiple conditions

    • Automated gradient generation and ATP detection systems

    • Rapid screening methods for mutant libraries

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Magnetic tweezers to measure rotational torque

    • High-speed atomic force microscopy to visualize rotation

  • In situ characterization:

    • Methods to measure ATP synthase activity in native membranes

    • Techniques to assess driving forces in living cells

    • Correlation of ATP synthesis with other cellular processes

  • Computational integration:

    • Molecular dynamics simulations to predict effects of mutations

    • Systems biology approaches linking ATP synthesis to cellular energetics

    • Machine learning for identifying patterns in experimental data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.