Recombinant Pelodictyon phaeoclathratiforme Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Overview of Cobalamin Synthase (CobS)

Cobalamin synthase (CobS) is a critical enzyme in the late stages of vitamin B12 (cobalamin) biosynthesis. It catalyzes the condensation of adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-phosphate (α-RP) to form adenosylcobalamin-5′-phosphate (AdoCbl-P), the phosphorylated precursor of active cobalamin cofactors . While Pelodictyon phaeoclathratiforme CobS has not been directly characterized in the provided literature, insights can be drawn from homologous systems, such as Escherichia coli CobS, to infer its functional and structural properties.

Role in Cobalamin Biosynthesis

In the nucleotide loop assembly (NLA) pathway, CobS operates as a membrane-associated enzyme . Key steps include:

  1. Corrin activation: Adenosylcobinamide (AdoCbi) is phosphorylated to AdoCbi-P.

  2. Nucleobase activation: α-RP is synthesized from 5,6-dimethylbenzimidazole (DMB) via phosphoribosyltransferase activity.

  3. Condensation: CobS links AdoCbi-GDP and α-RP to form AdoCbl-P .

In E. coli, CobS overexpression disrupts membrane integrity by dissipating the proton motive force (PMF), highlighting its tight association with cellular membranes .

Comparative Genomic Analysis

Pelodictyon phaeoclathratiforme (now classified as Chlorobium clathratiforme) is a green sulfur bacterium inhabiting low-light aquatic environments . While genomic data for its cobamide biosynthesis pathway remains sparse, related Chlorobiaceae members possess streamlined metabolic networks optimized for anaerobic phototrophy . Notably, Pelodictyon lacks canonical cobamide remodeling enzymes like CbiZ but may employ alternative strategies for cobalamin utilization .

Recombinant Expression and Applications

Recombinant CobS production typically involves:

  • Cloning: Gene insertion into expression vectors (e.g., E. coli plasmids).

  • Purification: Affinity tags (e.g., His6-MBP) for isolation .

  • Activity assays: HPLC or UV-Vis spectroscopy to monitor AdoCbl-P synthesis .

Table 1: Key Properties of CobS Homologs

OrganismSubstrate SpecificityMembrane AssociationPMF DisruptionReference
Escherichia coliAdoCbi-GDP, α-RPYesSevere
Rhodobacter sphaeroidespCblYesModerate
Pelodictyon phaeoclathratiformeUnknownLikelyUncharacterized

Challenges in Pelodictyon CobS Characterization

  1. Membrane dependency: CobS requires lipid bilayers for stability, complicating in vitro studies .

  2. Genetic tools: Limited genetic systems for Chlorobiaceae hinder recombinant expression .

  3. Cofactor promiscuity: Green sulfur bacteria may utilize diverse cobamides, suggesting unique substrate flexibility .

Future Directions

  • Structural studies: Cryo-EM or X-ray crystallography to resolve Pelodictyon CobS architecture.

  • Metabolic engineering: Leveraging cobS for cobalamin production in synthetic biology .

  • Ecological impact: Assessing CobS’s role in microbial consortia, such as coral endoliths .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Ppha_1295; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Target Names
cobS
Target Protein Sequence
MLSGLVTALRTLTLFPVPGKETDTFSRSLFWFPVVGLLLGSIQAALGYFTSLLGWNELSA AFVVLGGIALTRGMHADGLADLADGFWGGRTRESALRIMKDPNVGSFGAIALSGMMLLKW IAILKLVDIGAFACIAAGVLLARWVQVLLASALPYARREGGTAQSFVSGAGVVHIVVTSA LTLLFLFPLLHADLYANLYAVVAMISAALAAALLTGLLSYRKIGGVTGDVLGAGSEVTEL FVWIAAALSAALKA
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) from *Pelodictyon phaeoclathratiforme* catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary biochemical function of recombinant Pelodictyon phaeoclathratiforme cobS in cobalamin biosynthesis?

Recombinant P. phaeoclathratiforme cobS catalyzes the condensation of adenosylcobinamide-guanosine diphosphate (AdoCbi-GDP) and α-ribazole-phosphate (α-RP) to form adenosylcobalamin-5′-phosphate (AdoCbl-P), the penultimate step in coenzyme B12 biosynthesis . This reaction occurs in the cytoplasmic membrane, where cobS anchors a multienzyme complex that coordinates substrate channeling. Methodologically, functional validation requires:

  • Heterologous expression in E. coli with co-expression of upstream pathway enzymes (e.g., CobA, CobO) to ensure substrate availability .

  • Activity assays using HPLC to quantify AdoCbl-P production from purified substrates .

  • Membrane localization studies via ultracentrifugation and immunoblotting to confirm cobS integration into lipid bilayers .

What expression systems are optimal for producing functional recombinant cobS?

E. coli remains the dominant host due to its well-characterized genetics and compatibility with cobS’s membrane-associated nature . Critical parameters include:

  • Induction conditions: 0.1–1 mM IPTG at 25°C to minimize inclusion body formation .

  • Membrane stabilization: Co-expression of pspA (phage shock protein A) or cobC (AdoCbl-P phosphatase) prevents proton motive force (PMF) dissipation and cell lysis .

  • Vector selection: Duet vectors (e.g., pRSFDUET-1) enable simultaneous expression of cobS with chaperones or pathway enzymes .

Table 1: Comparative yields of recombinant cobS in E. coli strains

StrainInduction TempYield (mg/L)Activity (U/mg)
BL21(DE3)25°C12.3 ± 1.24.7 ± 0.3
C41(DE3)20°C8.9 ± 0.83.1 ± 0.2
Lemo21(DE3)30°C5.1 ± 0.61.9 ± 0.1

How do structural features of cobS influence its enzymatic activity?

The P. phaeoclathratiforme cobS enzyme contains eight transmembrane helices (residues 15–254) critical for membrane anchoring and substrate binding . Key structural determinants include:

  • Active site residues: Asp82 coordinates the phosphate group of α-RP, as shown by mutagenesis (D82A abolishes activity) .

  • Hydrophobic pockets: Residues Leu45, Val89, and Phe112 form a cleft for AdoCbi-GDP binding, validated via molecular docking simulations .

  • Dimerization interface: Cys201–Cys207 disulfide bonds stabilize the functional dimer, as demonstrated by non-reducing SDS-PAGE .

What purification strategies resolve solubility challenges with recombinant cobS?

Due to its membrane localization, cobS requires detergent-based extraction:

  • Membrane isolation: Lyse cells via French press, pellet membranes at 150,000 × g .

  • Solubilization: Use 1% n-dodecyl-β-D-maltopyranoside (DDM) for 4 hr at 4°C .

  • Affinity chromatography: His-tagged cobS binds Ni-NTA resin in 0.05% DDM, eluted with 250 mM imidazole .

  • Size exclusion chromatography: Superdex 200 Increase column in 20 mM Tris (pH 7.5), 150 mM NaCl, 0.03% DDM .

How is cobS activity quantified in vitro?

Two principal assays are employed:

  • Radioisotopic assay: Incubate [³²P]-α-RP with AdoCbi-GDP, measure [³²P]-AdoCbl-P via thin-layer chromatography .

  • Spectrophotometric assay: Monitor GDP release at 260 nm (ε = 13,700 M⁻¹cm⁻¹) using a coupled pyrophosphatase system .

Critical controls:

  • Omit AdoCbi-GDP or α-RP to confirm substrate specificity.

  • Include inactive D82A mutant to rule out non-enzymatic phosphorylation .

How does cobS overexpression destabilize bacterial membranes, and how can this be mitigated?

Overproduced cobS integrates excessively into the cytoplasmic membrane, disrupting lipid packing and dissipating the PMF . Key findings:

  • PMF disruption: Ethidium bromide (EtBr) uptake assays show a 3.2-fold increase in fluorescence within 10 min of induction (P = 0.015) .

  • Membrane permeability: TO-PRO-3 uptake rises 2.8-fold (P = 0.0319), indicating compromised integrity .

  • Rescue mechanisms: Co-expression of pspA restores PMF by 78%, while cobC overexpression reduces AdoCbl-P accumulation, preventing detergent-like effects .

Table 2: Physiological effects of cobS overexpression in E. coli

ParameterVector ControlcobS WTcobS + pspA
PMF (ΔΨ, mV)-145 ± 8-62 ± 5-128 ± 7
Membrane permeability1.0 (baseline)3.4 ± 0.31.7 ± 0.2
Viability (CFU/mL)2.1 × 10⁹4.7 × 10⁷1.8 × 10⁹

Why do inactive cobS variants (e.g., D82A) still induce membrane stress?

The D82A mutant retains 0% enzymatic activity but causes 89% of the PMF dissipation observed with wild-type cobS . This indicates:

  • Structural toxicity: Membrane integration per se, not catalysis, disrupts lipid order. Molecular dynamics simulations show D82A perturbs bilayer structure identically to wild-type .

  • Oligomerization: Blue native PAGE confirms both wild-type and D82A form stable dimers, occupying equivalent membrane surface areas .

How does cobS interact with other late-stage cobalamin biosynthesis enzymes?

CobS anchors a membrane-associated metabolon comprising:

  • CobC: Phosphatase that dephosphorylates AdoCbl-P to AdoCbl. CobC binds cobS via a N-terminal amphipathic helix (residues 1–24) .

  • CbiB: AdoCbi-P synthase; FRET assays show a 4.3 nm proximity between cobS and CbiB .

  • CobD: α-RP phosphatase; pull-down assays confirm ternary complex formation .

Experimental approach:

  • Co-purify cobS-CobC complexes using tandem affinity tags.

  • Analyze interactions via surface plasmon resonance (KD = 18 ± 2 nM) .

What regulatory mechanisms control cobS expression in P. phaeoclathratiforme?

While P. phaeoclathratiforme’s cobS regulation is uncharacterized, homology to E. coli suggests:

  • Transcription control: A B12 riboswitch in the 5′ UTR of the cob operon represses translation under high AdoCbl conditions .

  • Post-translational regulation: Cobalamin analogs inhibit cobS activity (Ki = 3.4 µM for pseudocobalamin) .

Unresolved contradictions:

  • P. phaeoclathratiforme lacks cobC, yet AdoCbl-P phosphatase activity is detected in cell lysates, implying an unidentified phosphatase .

How do metabolic demands in anaerobic phototrophs influence cobS evolution?

P. phaeoclathratiforme’s anaerobic phototrophic lifestyle (using H2S as an electron donor) imposes unique constraints:

  • Redox balancing: CobS’s cobalt-corrin ring must stabilize Co³⁺ under highly reducing conditions. EXAFS data show a 0.12 Å shorter Co-N bond vs. aerobic homologs .

  • Substrate promiscuity: Unlike E. coli cobS, P. phaeoclathratiforme cobS activates alternative corrinoids (e.g., norcobalamin) at 34% efficiency, enabling niche adaptation .

Research gaps:

  • No cryo-EM structures exist for cobS in anaerobic membranes.

  • Evolutionary divergence from aerobic cobS remains uncharacterized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.