Recombinant Pelodictyon phaeoclathratiforme Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mscL; Ppha_2788; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Target Names
mscL
Target Protein Sequence
MLKEFKEFAMKGNVVDMAVGIIVGGAFGTIVNTLVSQVLMPPLGLLIGGVDFTNLYLILK EGSKAAAPYAALADATAAGAVTVNYGLFLNSVISFLIMAFAVFLLVKAINMLRREEKAPP LAPTTKECPYCLSIVPLKATRCSSCTSELGK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pelodictyon phaeoclathratiforme and why is its mechanosensitive channel significant for research?

Pelodictyon phaeoclathratiforme is a brown-colored member of the Chlorobiaceae (green sulfur bacteria) family that forms distinctive net-like colonies. First isolated from the monimolimnion of Buchensee (near Lake Constance region, Germany), this bacterium is characterized by rod-shaped, nonmotile cells containing gas vacuoles and forms its signature net-like colonies through ternary fission of cells . As a strictly anaerobic and obligately phototrophic organism, it contains bacteriochlorophylls a and e, as well as isorenieratene and β-isorenieratene as major photosynthetic pigments, which distinguish it from the green-colored Pelodictyon clathratiforme .

The Large-conductance mechanosensitive channel (mscL) from this organism is significant for research because mechanosensitive channels serve as excellent model systems for studying the basic biophysical principles of mechanosensory transduction . These channels respond to membrane tension by opening in response to mechanical force transmitted directly from the lipid bilayer to the channel protein. Understanding how these channels function provides insights into fundamental mechanisms of environmental sensing in bacteria and may inform broader principles applicable to other mechanosensitive systems across diverse organisms. The unique evolutionary adaptations of this channel in an anaerobic, phototrophic bacterium may reveal novel aspects of mechanosensation in specialized ecological niches.

What expression systems are typically used for producing recombinant Pelodictyon phaeoclathratiforme mscL?

For effective production of recombinant Pelodictyon phaeoclathratiforme mscL, several expression systems can be employed, each with specific advantages for membrane protein expression. While the search results don't specify which systems are most commonly used for this particular protein, standard approaches for similar membrane proteins include:

  • Bacterial expression systems: Escherichia coli is the most common host for expressing bacterial membrane proteins, including mechanosensitive channels. Specialized strains like BL21(DE3), C41(DE3), or C43(DE3) that are optimized for membrane protein expression are frequently employed due to their reduced toxicity responses to foreign membrane protein overexpression.

  • Cell-free expression systems: These systems can overcome toxicity issues sometimes encountered with overexpression of membrane proteins in living cells, allowing direct incorporation into liposomes or nanodiscs for functional studies.

  • Yeast expression systems: Pichia pastoris or Saccharomyces cerevisiae may be used when higher eukaryotic post-translational modifications or quality control systems are beneficial, although this is less common for bacterial proteins.

For optimal expression, the gene encoding the Pelodictyon phaeoclathratiforme mscL would typically be codon-optimized for the host organism and cloned into an expression vector with an appropriate promoter and affinity tag (as indicated in product specifications, various tag types may be determined during the production process) . The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage to maintain stability .

What are the recommended protocols for functional reconstitution of recombinant Pelodictyon phaeoclathratiforme mscL for electrophysiological studies?

Functional reconstitution of recombinant Pelodictyon phaeoclathratiforme mscL for electrophysiological studies follows established protocols for mechanosensitive channels, with protein-specific optimizations. Based on methodologies used for similar channels, the following protocol framework is recommended:

  • Purification of recombinant protein:

    • Solubilize the membrane fraction containing the expressed protein using appropriate detergents (commonly n-dodecyl-β-D-maltopyranoside (DDM) or Triton X-100)

    • Purify using affinity chromatography based on the attached tag

    • Verify purity using SDS-PAGE and Western blotting

    • Remove aggregates via size exclusion chromatography if necessary

  • Liposome reconstitution:

    • Prepare lipid mixture (typically azolectin for bacterial channels)

    • Form liposomes through detergent removal via dialysis or Bio-Beads

    • Incorporate the purified protein at appropriate protein-to-lipid ratios (typically 1:200 to 1:1000)

    • Verify successful reconstitution by freeze-fracture electron microscopy or functional assays

  • Electrophysiological recording:

    • Form patches from proteoliposomes using patch-clamp techniques

    • Apply negative pressure to induce channel opening

    • Record channel currents using standard electrophysiology equipment

    • Use MscS as a gauge to determine the activation threshold and relative sensitivity

From published research on related mechanosensitive channels, co-reconstitution with MscS is often performed to provide an internal reference for pressure sensitivity . This approach helps normalize variations in patch geometry and membrane properties across experiments, allowing more reliable comparison of activation thresholds between wild-type and mutant channels or between different experimental conditions.

How can researchers assess the mechanosensitivity of Pelodictyon phaeoclathratiforme mscL and compare it with other mechanosensitive channels?

Assessing the mechanosensitivity of Pelodictyon phaeoclathratiforme mscL requires rigorous experimental approaches with appropriate controls. Based on methodologies used for related channels, researchers can implement the following strategies:

  • Patch-clamp electrophysiology in liposomes:

    • Co-reconstitute the recombinant mscL with a well-characterized channel like MscS to serve as an internal reference

    • Calculate the pressure ratio (P₁/₂ ratio) between the test channel and reference channel

    • This ratio represents the relative pressure sensitivity, with higher values indicating lower sensitivity

    • For accurate comparison, maintain consistent recording conditions (pipette geometry, membrane composition)

  • In vivo functional assays:

    • Express the channel in MscL-deficient E. coli strains (such as MJF612: MscL−, MscS−, MscK− and YbdG−)

    • Subject cells to hypo-osmotic shock and measure survival rates

    • Decreased survival rates indicate impaired channel function or altered gating properties

    • Quantify the degree of protection against osmotic downshock compared to controls

  • Spectroscopic methods for conformational changes:

    • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy

    • This approach can detect mobility changes in specific regions of the protein (e.g., TM2) during gating

    • Calculate mobility parameters to quantify conformational flexibility in different states

    • Compare spectral changes between resting state and LPC-activated state (which stabilizes the open conformation)

The table below summarizes typical findings when comparing wild-type mscL with channels containing modifications to the N-terminal region:

Channel VariantP₁/₂ Ratio (relative to MscS)Effect on MechanosensitivityMobility Parameter (TM2)
Wild-type mscL1.8 ± 0.07ReferenceLow
+2G linker2.6 ± 0.06Decreased sensitivityIncreased
+5G linker3.0 ± 0.21Severely decreased sensitivitySignificantly increased
With LPCLowerIncreased sensitivitySignificantly increased

These combined approaches provide a comprehensive assessment of mechanosensitivity and allow direct comparison with other mechanosensitive channels .

What strategies can be employed to study the N-terminal region's role in Pelodictyon phaeoclathratiforme mscL gating?

The N-terminal region of mechanosensitive channels plays a crucial role in channel gating. To investigate this region's function in Pelodictyon phaeoclathratiforme mscL, researchers can employ several complementary experimental strategies:

  • Deletion analysis:

    • Create a series of N-terminal deletion mutants (e.g., Δ2-7, progressive deletions)

    • Assess the effect on channel function using patch-clamp electrophysiology and in vivo assays

    • Quantify changes in pressure sensitivity (P₁/₂ ratio) relative to wild-type channels

    • Determine the minimum N-terminal sequence required for normal function

  • Site-directed mutagenesis:

    • Target key residues in the N-terminal region, particularly charged amino acids that may form electrostatic interactions

    • Substitute residues to alter charge, hydrophobicity, or size

    • Evaluate effects on channel function and sensitivity

    • Map interaction networks between the N-terminus and other regions of the protein

  • Linker extension experiments:

    • Insert glycine residues between the N-terminal helix and TM1 (e.g., +2G and +5G mutations)

    • This disrupts the normal positioning of the N-terminus relative to the transmembrane domains

    • Measure changes in channel opening and closing kinetics

    • Research on related channels shows that extending the Gly14 linker significantly impacts mechanosensitivity, with +2G and +5G mutants requiring substantially more force to open

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • Introduce spin labels at specific positions within TM2 to monitor its mobility

    • Compare mobility parameters between wild-type and N-terminal mutants

    • Correlate increased TM2 mobility with deletion of specific N-terminal residues

    • Studies on similar channels show that removing more than five residues from the N-terminus significantly increases TM2 mobility, suggesting loss of stabilizing interactions

These approaches can be combined to develop a comprehensive understanding of how the N-terminal region contributes to channel function, potentially revealing conserved mechanisms across mechanosensitive channels from diverse bacterial species.

How does the lipid environment affect Pelodictyon phaeoclathratiforme mscL function, and what methods can be used to investigate this relationship?

The lipid environment critically influences mechanosensitive channel function since these channels directly sense membrane tension. For Pelodictyon phaeoclathratiforme mscL, researchers can investigate this relationship using several sophisticated approaches:

  • Reconstitution in defined lipid compositions:

    • Prepare liposomes with systematic variations in:

      • Acyl chain length and saturation

      • Headgroup composition

      • Inclusion of bacterial lipids (e.g., cardiolipin)

    • Measure channel activity in each lipid environment using patch-clamp electrophysiology

    • Determine how lipid properties affect the pressure threshold for activation

    • Quantify the energetics of channel gating in different membrane contexts

  • Effects of membrane-active compounds:

    • Test lysophosphatidylcholine (LPC), which alters membrane curvature and can stabilize the open state of mechanosensitive channels

    • Compare mobility parameters of specific regions (e.g., TM2) in the presence and absence of LPC

    • Assess how these compounds modify the energetics of channel gating

    • Use EPR spectroscopy to monitor conformational changes induced by membrane-active compounds

  • Fluorescence-based approaches:

    • Incorporate environment-sensitive fluorophores at specific positions

    • Monitor changes in fluorescence as the channel transitions between states

    • Correlate these changes with lipid composition

    • Track lipid reorganization around the channel during gating

  • Computational modeling:

    • Perform molecular dynamics simulations of the channel in various lipid environments

    • Analyze lipid-protein interactions and their impact on channel stability

    • Identify specific lipid binding sites that may regulate channel function

    • Model how membrane deformation affects force transmission to the channel

The table below summarizes the expected effects of different membrane modifications on mscL function:

Membrane ModificationEffect on Gating ThresholdEffect on TM2 MobilityMechanism
Addition of LPCDecreasedIncreasedInduces positive curvature strain
Increased acyl chain lengthIncreasedDecreasedIncreases hydrophobic mismatch
Increased membrane tensionDecreasedIncreasedDirect force transmission to channel
Cholesterol inclusionVariableDecreasedModifies membrane fluidity and thickness

These approaches provide complementary insights into the critical relationship between membrane properties and channel function, which is central to mechanosensation.

What insights can molecular dynamics simulations provide about the gating mechanism of Pelodictyon phaeoclathratiforme mscL?

Molecular dynamics (MD) simulations offer powerful insights into the atomic-level mechanisms of mscL gating that are difficult to obtain experimentally. For Pelodictyon phaeoclathratiforme mscL, these computational approaches can reveal:

  • Conformational transitions during gating:

    • Map the pathway from closed to open states with nanosecond temporal resolution

    • Identify intermediate conformations that may be too transient to capture experimentally

    • Calculate energy barriers between conformational states

    • Visualize the coordinated movements of channel subunits during the gating process

  • Key interactions stabilizing different states:

    • Analyze electrostatic interactions between protein domains

    • MD simulations of related channels have revealed strong interactions between Glu residues on the N-terminus (E6 and E9) and residues on adjacent subunits

    • Identify hydrophobic interactions at the protein-lipid interface

    • Quantify the strength of these interactions and their contribution to channel stability

  • Lipid-protein interactions during tension sensing:

    • Examine how membrane deformation affects protein conformation at the atomic level

    • Track specific lipid molecules that interact with the channel during gating

    • Determine how membrane thickness changes influence channel opening

    • Model the redistribution of lipids around the channel in different conformational states

  • Water permeation and ion conduction:

    • Model the formation of the water-filled pore during opening with atomic detail

    • Calculate conductance properties and ion selectivity from first principles

    • Compare with experimental electrophysiology data for validation

    • Identify residues that control the energetics of ion and water passage

  • Effects of mutations on channel function:

    • Simulate the impact of N-terminal modifications on channel behavior

    • Predict functional outcomes of specific mutations before experimental testing

    • Guide experimental design for validation studies

    • Provide mechanistic explanations for experimentally observed phenotypes

MD simulations can specifically address the role of the amphipathic N-terminal helix in stabilizing the closed state and coupling the channel to the membrane . By simulating membrane tension application with and without modifications to this region, researchers can elucidate its precise contribution to mechanosensitivity and potentially identify novel therapeutic targets for related channels.

What approaches can be used to study potential interactions between Pelodictyon phaeoclathratiforme mscL and other membrane proteins in bacterial membranes?

Investigating interactions between Pelodictyon phaeoclathratiforme mscL and other membrane proteins requires sophisticated biochemical and biophysical techniques:

  • Co-immunoprecipitation and pull-down assays:

    • Use antibodies against the recombinant mscL or its affinity tag

    • Identify interacting proteins by mass spectrometry analysis of co-purified proteins

    • Validate interactions with reverse co-immunoprecipitation

    • Determine whether interactions are direct or mediated by other components

  • Förster Resonance Energy Transfer (FRET):

    • Label mscL and potential interaction partners with compatible fluorophores

    • Measure energy transfer as an indicator of protein proximity (<10 nm)

    • Perform in native membrane environments or reconstituted systems

    • Quantify interaction dynamics in response to changes in membrane tension

  • Cross-linking coupled with mass spectrometry:

    • Apply chemical cross-linkers to stabilize transient interactions

    • Digest cross-linked complexes and analyze by mass spectrometry

    • Identify specific residues involved in protein-protein contacts

    • Map the interaction interface at the amino acid level

  • Super-resolution microscopy:

    • Visualize the spatial organization of fluorescently labeled proteins

    • Track dynamic associations in response to membrane tension

    • Quantify co-localization coefficients under different conditions

    • Determine whether proteins form functional clusters in the membrane

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split a fluorescent protein and fuse each half to potential interaction partners

    • Reconstitution of fluorescence indicates protein-protein interaction

    • Can be performed in living bacterial cells

    • Monitor interaction dynamics in real-time

  • Bacterial two-hybrid systems:

    • Adapt yeast two-hybrid methodology for membrane proteins

    • Screen for potential interaction partners from genomic libraries

    • Validate identified interactions with other methods

    • Quantify interaction strengths between different protein pairs

This multifaceted approach can reveal whether Pelodictyon phaeoclathratiforme mscL functions independently or as part of a larger mechanosensory complex, potentially identifying novel interactions specific to anaerobic, phototrophic bacteria that could represent adaptations to their unique ecological niche.

What spectroscopic methods are most effective for studying conformational changes in Pelodictyon phaeoclathratiforme mscL?

Several spectroscopic techniques can be employed to study conformational changes in Pelodictyon phaeoclathratiforme mscL, each offering unique insights into protein dynamics:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling (SDSL) with nitroxide probes at specific residues

    • Measures mobility parameters that reflect local conformational changes

    • Particularly valuable for tracking movements of transmembrane domains

    • Research on related channels has used this approach to monitor mobility changes in TM2 during gating

    • Continuous wave EPR provides information about spin label mobility and accessibility

    • Double electron-electron resonance (DEER) measures distances between spin labels (2-8 nm)

  • Fluorescence Spectroscopy:

    • Site-specific labeling with environment-sensitive fluorophores

    • Measure changes in fluorescence intensity, lifetime, or anisotropy

    • Can detect subtle conformational changes in real-time

    • Useful for studying the kinetics of channel gating

    • Single-molecule FRET can track conformational changes in individual channel complexes

  • Förster Resonance Energy Transfer (FRET):

    • Label pairs of residues with donor and acceptor fluorophores

    • Measure distance changes between labeled sites during gating

    • Can provide quantitative information about conformational transitions

    • Time-resolved FRET reveals the dynamics of conformational changes

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Solution NMR of isotopically labeled protein

    • Solid-state NMR for membrane-embedded channels

    • Provides detailed structural information about specific regions

    • Can detect dynamic changes in protein conformation

    • Chemical shift analysis reveals local environmental changes during gating

The relative effectiveness of these methods for different aspects of channel function is summarized in the table below:

Spectroscopic MethodSpatial ResolutionTemporal ResolutionIn-membrane ApplicationStrengths for mscL Studies
EPR/SDSL0.5-2 nmμs-msExcellentDirectly measures TM2 mobility changes
Fluorescence1-10 nmns-sGoodReal-time monitoring of conformational changes
FRET2-10 nmns-sGoodMeasures specific distance changes during gating
NMRAtomicμs-msChallengingAtomic-level structural information

For studying the N-terminal region specifically, EPR spectroscopy has proven particularly valuable. In studies of similar channels, researchers have used spin labels at positions like M94 to monitor mobility changes in TM2 when residues are deleted from the N-terminus or when membrane-active compounds like LPC are added .

How can cryo-electron microscopy be optimized for structural studies of Pelodictyon phaeoclathratiforme mscL in different conformational states?

Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and can be optimized for studying Pelodictyon phaeoclathratiforme mscL in different conformational states using the following strategies:

  • Sample preparation optimization:

    • Test different detergents and nanodiscs for protein stability and homogeneity

    • Optimize protein concentration and buffer conditions

    • Use amphipols or styrene-maleic acid copolymer lipid particles (SMALPs) to maintain native-like lipid environment

    • Screen various grid types and freezing conditions to optimize ice thickness and particle distribution

  • Trapping different conformational states:

    • Use membrane tension mimetics (like LPC) to stabilize the open state

    • Apply engineered disulfide bridges to trap intermediate states

    • Employ mutations that bias the channel toward specific conformations

    • Combine with rapid freezing techniques to capture transient states

  • Data collection strategies:

    • Collect tilt series to address preferred orientation issues common with membrane proteins

    • Use energy filters to improve signal-to-noise ratio

    • Employ phase plates for enhanced contrast, especially important for smaller membrane proteins

    • Implement beam-induced motion correction for higher resolution

  • Image processing optimizations:

    • Apply 3D variability analysis to identify and classify conformational heterogeneity

    • Use focused classification to resolve flexible regions like the N-terminal domain

    • Implement multi-body refinement to account for domain movements

    • Employ Bayesian particle polishing for improved resolution

The table below outlines strategies for capturing different conformational states of mscL:

Conformational StateStabilization StrategyExpected ResolutionChallenges
Closed (resting)Native conditions3-4 ÅNatural state, relatively stable
IntermediateDisulfide crosslinking4-5 ÅHeterogeneity, transient nature
OpenLPC addition 4-6 ÅConformational flexibility, heterogeneity
N-terminal interactionsTargeted mutations3-5 ÅLocal flexibility, domain movements

By implementing these optimizations, researchers can potentially resolve the structure of Pelodictyon phaeoclathratiforme mscL in multiple conformational states, providing unprecedented insights into the molecular mechanisms of mechanosensation in this unique bacterial species.

What are the current challenges and limitations in expressing and purifying Pelodictyon phaeoclathratiforme mscL for structural studies?

Expression and purification of Pelodictyon phaeoclathratiforme mscL for structural studies presents several challenges common to membrane proteins, with additional complications specific to this protein:

  • Expression challenges:

    • Low expression levels typical of membrane proteins

    • Potential toxicity to host cells when overexpressed

    • Proper folding in heterologous expression systems

    • Adaptation of codon usage for the expression host

    • Special considerations for a protein from an anaerobic organism when expressed in aerobic hosts

  • Extraction and solubilization issues:

    • Finding optimal detergents that maintain native structure

    • Balancing extraction efficiency with protein stability

    • Preventing aggregation during solubilization

    • Maintaining the pentameric assembly during purification

    • Preserving critical lipid-protein interactions

  • Purification complications:

    • Achieving high purity without compromising stability

    • Removing tightly bound lipids if necessary

    • Optimizing buffer conditions for protein stability

    • Preventing protein degradation during purification steps

    • Maintaining protein in a functional state throughout the process

  • Conformational heterogeneity:

    • Mechanosensitive channels exist in an ensemble of conformations

    • Difficulty in capturing specific states for structural analysis

    • Potential for detergent-induced conformational changes

    • Need for strategies to trap desired conformational states

The recommended storage conditions for recombinant Pelodictyon phaeoclathratiforme mscL provide some insights into stability requirements: Tris-based buffer with 50% glycerol, stored at -20°C or -80°C for extended storage, with repeated freezing and thawing not recommended . These conditions suggest the protein may have stability issues common to membrane proteins.

Addressing these challenges requires systematic optimization of expression conditions, detergent screening, and purification protocols specific to Pelodictyon phaeoclathratiforme mscL. The unique properties of this channel from an anaerobic, phototrophic bacterium may necessitate specialized approaches not typically used for membrane proteins from more commonly studied organisms.

How does Pelodictyon phaeoclathratiforme mscL compare functionally with mechanosensitive channels from non-photosynthetic bacteria?

Comparing Pelodictyon phaeoclathratiforme mscL with mechanosensitive channels from non-photosynthetic bacteria reveals important insights into functional conservation and adaptation:

  • Functional conservation:

    • The basic mechanism of tension sensing through the lipid bilayer is likely conserved

    • The role of the amphipathic N-terminal helix in gating appears to be a common feature

    • Core structural elements that form the channel pore are generally conserved

    • Electrostatic interactions between the N-terminus and TM2 helix are critical for stabilizing the closed state in multiple bacterial species

  • Activation thresholds:

    • Different bacterial species may have evolved distinct sensitivity thresholds based on their environmental niches

    • Photosynthetic bacteria like Pelodictyon phaeoclathratiforme inhabit specialized environments (anaerobic water columns) that may require specific adaptations

    • Comparative electrophysiology studies can reveal these differences in tension sensitivity

    • The presence of gas vacuoles in Pelodictyon phaeoclathratiforme suggests unique osmotic regulation needs that could influence mechanosensitive channel function

  • Gating kinetics:

    • Opening and closing rates may differ between channels from different bacterial origins

    • These differences could reflect adaptation to specific environmental challenges

    • For example, soil bacteria may require faster response to rapid osmotic changes compared to aquatic photosynthetic bacteria

    • The pressure-of-first-opening/pressure-of-last-closing ratio provides insights into hysteresis in channel gating

  • Modulation by environmental factors:

    • Channels from photosynthetic bacteria may have evolved unique responses to light-dependent processes

    • pH sensitivity might differ based on the typical environmental conditions

    • Temperature responses may be optimized for the bacteria's natural habitat

    • Sulfide concentration, a key factor for green sulfur bacteria , may influence channel function

The evolutionary relationship between mechanosensitive channels from diverse bacteria represents a fascinating example of how a conserved molecular mechanism can be fine-tuned to serve in widely different ecological niches and metabolic contexts, from aerobic heterotrophs to anaerobic phototrophs like Pelodictyon phaeoclathratiforme.

What insights can be gained from comparing the genomic context of the mscL gene in Pelodictyon phaeoclathratiforme with other bacterial species?

Analyzing the genomic context of the mscL gene in Pelodictyon phaeoclathratiforme compared to other bacterial species can provide valuable insights into its regulation, function, and evolutionary history:

  • Operon structure and co-transcribed genes:

    • Identification of genes consistently found near mscL across species

    • In Pelodictyon phaeoclathratiforme, the mscL gene is designated as Ppha_2788

    • Determining whether mscL is part of a larger transcriptional unit or independently regulated

    • Identifying potential functional relationships with nearby genes

  • Regulatory elements:

    • Comparative analysis of promoter regions and transcription factor binding sites

    • Identification of conserved regulatory motifs across bacterial lineages

    • Species-specific regulatory elements that may reflect adaptation to different environments

    • Potential links to stress response pathways or photosynthesis regulation

  • Horizontal gene transfer events:

    • Evidence of recent gene transfer based on GC content, codon usage, or phylogenetic incongruence

    • The GC content of Pelodictyon phaeoclathratiforme DNA is 47.9 mol% G+C , which can be used as a reference point

    • Assessment of whether mscL shows different evolutionary patterns compared to housekeeping genes

  • Gene duplication and diversification:

    • Presence of paralogous mechanosensitive channel genes within the same genome

    • Functional specialization following gene duplication events

    • Conservation of duplicate copies across related species

    • Potential adaptations to specific environmental pressures

The comparative analysis should include diverse bacterial species from different ecological niches, with special attention to other photosynthetic bacteria and close relatives of Pelodictyon phaeoclathratiforme. This approach can reveal not only the evolutionary history of mscL but also provide hypotheses about its physiological role and regulation in the specific context of this unique bacterium's lifestyle as an anaerobic, phototrophic organism forming distinctive net-like colonies .

What experimental approaches can be used to investigate the physiological role of mechanosensitive channels in Pelodictyon phaeoclathratiforme's natural environment?

Investigating the physiological role of mechanosensitive channels in Pelodictyon phaeoclathratiforme's natural environment presents unique challenges due to its specialized ecological niche as an anaerobic, phototrophic bacterium. Several experimental approaches can address these challenges:

  • Environmental sampling and in situ gene expression:

    • Collect samples from environments where Pelodictyon phaeoclathratiforme naturally occurs, such as the monimolimnion of stratified lakes

    • Use quantitative RT-PCR or RNA-seq to measure mscL expression under natural conditions

    • Correlate expression levels with environmental parameters (light, sulfide concentration, osmolarity)

    • Compare expression patterns across different depths and seasons

  • Laboratory simulation of environmental conditions:

    • Create microcosms that mimic the organism's natural habitat

    • Systematically vary key parameters (osmotic pressure, light intensity, sulfide concentration)

    • Monitor changes in mscL expression and channel activity

    • Assess impacts on colony formation and gas vacuole integrity

  • Genetic manipulation approaches:

    • Develop genetic tools for Pelodictyon phaeoclathratiforme if not already available

    • Create mscL knockout or knockdown strains

    • Assess phenotypic consequences under various environmental stresses

    • Complement with wild-type or mutant versions to confirm specificity

  • Physiological measurements:

    • Monitor changes in cell volume, net-like colony structure , and gas vacuole integrity

    • Measure ion fluxes in response to osmotic challenges

    • Investigate potential roles in buoyancy regulation via the gas vacuoles

    • Assess impacts on photosynthetic efficiency under different osmotic conditions

The table below outlines key environmental parameters to consider when investigating mscL function in Pelodictyon phaeoclathratiforme:

Environmental ParameterPotential Impact on mscL FunctionMeasurement ApproachEcological Significance
Light intensityMay affect energy availability for channel functionLight meters, photosynthetic activity measurementsCritical for phototrophic lifestyle
Sulfide concentrationMay influence membrane propertiesColorimetric assays, electrochemical methodsEssential electron donor for photosynthesis
Osmotic pressureDirect trigger for channel activationOsmometer measurements, controlled media compositionAffects cell volume and gas vacuole integrity
Depth in water columnCombines effects of light, pressure, and chemistryVertical profiling of natural habitatsDetermines ecological niche

These approaches would help elucidate how mechanosensitive channels contribute to Pelodictyon phaeoclathratiforme's remarkable adaptations to its specialized ecological niche, including its ability to form distinctive net-like colonies and maintain position in stratified water columns using gas vacuoles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.