Recombinant Pelodictyon phaeoclathratiforme Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lspA; Ppha_2067; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Target Names
lspA
Target Protein Sequence
MKLFFSIVLLVITLDQFTKKLALTFLRDGVQSITIIADLFSLTYAENRGVAFGLEFAPPT VLLLLTGVITIMVLAYVIWSKNRTTLFLLPFALITGGGIGNMIDRVMYGKVVDFIYFDLY QGHIFGRWVSLWPIFNIADSAITIGACMLMIFHNKLFPAESPTGTTDVR
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pelodictyon phaeoclathratiforme and why is its LspA of research interest?

Pelodictyon phaeoclathratiforme is a photosynthetic green nonsulfur bacterium containing bacteriochlorophyll e as its major chlorosome pigment . This organism belongs to a phylogenetically diverse group of bacteria that have significant ecological importance in various environments. The lipoprotein signal peptidase (LspA) from this organism is of particular research interest because it represents an opportunity to study this enzyme in photosynthetic bacteria, which may reveal evolutionary adaptations and functional specializations distinct from the more commonly studied pathogenic bacterial LspA variants.

Green nonsulfur bacteria like Pelodictyon phaeoclathratiforme contain unique membrane structures associated with photosynthesis, including chlorosomes and specialized cell envelope architectures . The LspA enzyme plays a critical role in processing lipoproteins destined for the cell envelope, making it an excellent subject for comparative studies with LspA from non-photosynthetic bacteria. These comparisons may reveal how LspA has adapted to function in diverse bacterial physiologies and membrane environments.

How does LspA function in bacterial lipoprotein processing?

LspA (lipoprotein signal peptidase) is an essential enzyme in the bacterial lipoprotein processing pathway. It functions as the second enzyme in this pathway, following Lgt (prolipoprotein diacylglyceryl transferase). LspA specifically cleaves the signal peptide from prolipoproteins after they have been lipidated by Lgt, producing mature lipoproteins that are critical for cell envelope integrity and function .

The processing mechanism involves:

  • Recognition of the "lipobox" motif in prolipoproteins

  • Cleavage of the signal peptide at the conserved cysteine residue (which has been previously modified by Lgt)

  • Release of the mature lipoprotein for insertion into the membrane

Methodologically, LspA activity can be assessed using:

  • Gel-shift assays with recombinant prolipoprotein substrates

  • FRET-based assays using synthetic lipopeptide substrates

In experimental systems, LspA activity is often measured through coupled assays where Lgt first modifies a prolipoprotein substrate (such as proICP), which is then cleaved by LspA. The processing can be visualized by gel electrophoresis, where the cleaved product shows a characteristic mobility shift .

What expression systems are most effective for recombinant Pelodictyon phaeoclathratiforme LspA production?

Based on methods used for other LspA proteins, the expression of recombinant Pelodictyon phaeoclathratiforme LspA would likely be most effective using specialized systems designed for membrane proteins. The following approach would be recommended:

  • Vector selection: pET-based expression vectors with a hexahistidine tag for purification, similar to those used successfully for Staphylococcus aureus LspA .

  • Host strains: E. coli C41(DE3) or C43(DE3), which are engineered for membrane protein expression, or BL21(DE3) with co-expression of chaperones to aid proper folding.

  • Expression conditions:

    • Induction at lower temperatures (16-20°C) to prevent inclusion body formation

    • Lower IPTG concentrations (0.1-0.5 mM) for slower, more controlled expression

    • Longer expression times (16-24 hours)

  • Membrane fraction preparation:

    • Cell lysis by sonication or high-pressure homogenization

    • Differential centrifugation to isolate membrane fractions

    • Solubilization with appropriate detergents (LMNG has been effective for other LspA proteins)

  • Purification strategy:

    • IMAC (immobilized metal affinity chromatography) using the His-tag

    • Size exclusion chromatography to remove aggregates

    • Maintenance in detergent micelles throughout purification

This approach has been successful for orthologous LspA proteins and would need to be optimized specifically for the Pelodictyon phaeoclathratiforme enzyme, considering its unique physiochemical properties.

What are the key structural features expected in Pelodictyon phaeoclathratiforme LspA?

While no crystal structure of Pelodictyon phaeoclathratiforme LspA is currently available in the search results, we can infer likely structural features based on known structures of LspA from other bacteria:

  • Transmembrane architecture: Likely contains four transmembrane helices embedded in the cytoplasmic membrane, with both N- and C-termini located on the same side of the membrane .

  • Catalytic residues: Expected to contain conserved aspartate residues forming the catalytic dyad or triad essential for peptidase activity.

  • Substrate binding pocket: Likely possesses a hydrophobic binding cleft that accommodates the lipidated N-terminus of the substrate prolipoprotein.

  • Conserved motifs: Should contain the signature sequences typical of aspartic proteases in the Type II signal peptidase family.

The crystal structure of S. aureus LspA revealed that the enzyme forms a compact four-helix bundle with a substrate-binding cavity accessible from both the periplasm and the membrane . The active site is likely formed by conserved aspartate residues positioned to perform nucleophilic attack on the scissile bond of the substrate. Given the functional conservation of LspA across bacterial species, Pelodictyon phaeoclathratiforme LspA would be expected to share these core structural features while potentially displaying unique adaptations reflecting its role in a photosynthetic bacterium.

How might inhibition profiles of Pelodictyon phaeoclathratiforme LspA compare to those from pathogenic bacteria?

The inhibition profiles of Pelodictyon phaeoclathratiforme LspA would likely show both similarities and differences compared to those from pathogenic bacteria like Staphylococcus aureus. Based on the inhibition studies of LspA from other bacteria, we can make the following comparative analysis:

Inhibitor CharacteristicPathogenic Bacterial LspA (e.g., S. aureus)Predicted P. phaeoclathratiforme LspA Response
Globomycin sensitivityIC₅₀ varies (tight binding in P. aeruginosa, less sensitive in S. aureus) Potentially different due to unique membrane composition in photosynthetic bacteria
Myxovirescin bindingBinds as tetrahedral intermediate analog May show altered binding affinity due to evolutionary divergence
Inhibitor binding motif19-atom motif recognized in both globomycin and myxovirescin Conservation of binding pocket would determine similar recognition patterns
Natural resistance mechanismsVarious species-specific sensitivity levels May possess unique resistance mechanisms reflecting ecological niche

Research methodologies to investigate these differences would include:

  • Comparative enzyme inhibition assays: Using purified recombinant LspA from both P. phaeoclathratiforme and pathogenic bacteria with standardized FRET-based assays .

  • Structural analysis: Obtaining crystal structures of P. phaeoclathratiforme LspA with and without inhibitors to identify unique binding interactions.

  • Mutagenesis studies: Creating chimeric enzymes swapping domains between pathogenic and photosynthetic bacterial LspA to identify regions responsible for differential inhibitor sensitivity.

  • Molecular dynamics simulations: Computational analysis of inhibitor binding to predict differences in binding energy and conformational changes.

The study of inhibition profiles could reveal important evolutionary adaptations in enzyme structure and function across diverse bacterial phyla, potentially identifying novel inhibitor design strategies specific to different bacterial groups.

What methodological approaches are most effective for assessing LspA activity in Pelodictyon phaeoclathratiforme?

Assessment of LspA activity in Pelodictyon phaeoclathratiforme would require specialized approaches that account for the unique characteristics of this photosynthetic bacterium. Based on established methods for other LspA enzymes, the following methodological approaches would be most effective:

1. Gel-shift assay protocol:

  • Express and purify a native Pelodictyon phaeoclathratiforme prolipoprotein substrate

  • Perform coupled reactions with recombinant Lgt and LspA enzymes

  • Reaction conditions: 37°C in buffer containing appropriate detergent (e.g., 0.02% LMNG)

  • Include DOPG (250 μM) to provide lipid substrate for Lgt

  • Visualize processing by SDS-PAGE and detect mobility shift between prolipoprotein and mature protein

2. FRET-based activity assay:

  • Design synthetic FRET lipopeptide substrates mimicking native P. phaeoclathratiforme prolipoproteins

  • Optimize reaction conditions: temperature, pH, ionic strength, and detergent concentration

  • Monitor fluorescence (Ex/Em: 320 nm/420 nm) for 30-60 minutes at 37°C

  • Calculate initial reaction rates from fluorescence intensity versus time plots

3. Specialized considerations for P. phaeoclathratiforme:

  • Include chlorosome membrane components in reaction buffers to better mimic native environment

  • Adjust assay temperature to reflect optimal growth conditions for this bacterium

  • Consider anaerobic assay conditions to maintain enzyme in native state

  • Incorporate bacteriochlorophyll e content analysis to assess effects on photosynthetic apparatus

4. Data analysis approach:

  • Determine enzyme kinetic parameters (Km, Vmax, kcat) under varying substrate and inhibitor concentrations

  • Compare activity against different substrate sequences to establish specificity profiles

  • Evaluate pH and temperature optima specific to this organism's physiological conditions

5. Validation strategies:

  • Create site-directed mutants of conserved catalytic residues to confirm mechanism

  • Develop in vivo complementation assays in P. phaeoclathratiforme or related green nonsulfur bacteria

  • Use mass spectrometry to confirm precise cleavage sites in processed lipoproteins

These methodological approaches would need to be optimized specifically for P. phaeoclathratiforme, taking into account its growth requirements and the biochemical environment of its membrane systems.

What is the relationship between LspA function and chlorosome membrane organization in green nonsulfur bacteria?

The relationship between LspA function and chlorosome membrane organization in green nonsulfur bacteria like Pelodictyon phaeoclathratiforme represents an intriguing area for investigation, given the unique photosynthetic structures found in these organisms. Although direct experimental evidence is limited in the search results, we can propose the following relationships based on known functions of LspA and chlorosome biology:

  • Lipoprotein distribution in specialized membranes: Chlorosomes are specialized photosynthetic organelles containing bacteriochlorophyll e in P. phaeoclathratiforme . LspA likely processes specific lipoproteins destined for:

    • The chlorosome envelope membrane

    • The cytoplasmic membrane adjacent to chlorosome attachment sites

    • Specialized membrane domains involved in energy transduction

  • Photosynthetic complex assembly: Properly processed lipoproteins may be essential for:

    • Anchoring chlorosomes to the cytoplasmic membrane

    • Forming functional electron transport complexes

    • Maintaining the structural integrity of photosynthetic apparatuses

  • Regulatory functions: LspA-processed lipoproteins may participate in:

    • Light harvesting efficiency regulation

    • Adaptation to changing light conditions

    • Signaling between photosynthetic apparatus and cellular metabolism

Research methodology to investigate these relationships would involve:

  • Comparative genomics and proteomics:

    • Identify putative lipoproteins in P. phaeoclathratiforme genome using lipobox prediction algorithms

    • Compare lipoprotein profiles between photosynthetic and non-photosynthetic bacteria

    • Identify lipoproteins specifically associated with chlorosome functions

  • Functional studies:

    • Create conditional LspA mutants in P. phaeoclathratiforme or related green nonsulfur bacteria

    • Analyze effects on chlorosome assembly, structure, and function

    • Measure changes in photosynthetic efficiency when LspA activity is modulated

  • Localization experiments:

    • Use fluorescently labeled antibodies against processed lipoproteins to visualize distribution

    • Perform subcellular fractionation to identify which membrane systems contain specific lipoproteins

    • Correlate lipoprotein distribution with chlorosome membrane organization

This research would provide valuable insights into the unique adaptations of lipoprotein processing systems in photosynthetic bacteria and how they contribute to specialized membrane structures essential for photosynthesis.

How does the phylogenetic relationship of Pelodictyon phaeoclathratiforme influence recombinant LspA research approaches?

The phylogenetic position of Pelodictyon phaeoclathratiforme within green nonsulfur bacteria has significant implications for recombinant LspA research approaches. Analysis of its evolutionary relationships informs multiple aspects of experimental design and interpretation:

  • Sequence-based considerations:

    • P. phaeoclathratiforme belongs to the diverse group of green nonsulfur bacteria, which are phylogenetically distinct from proteobacteria and firmicutes where most LspA research has been conducted

    • This phylogenetic distance likely results in sequence variations in LspA that must be accounted for in primer design, codon optimization, and expression system selection

    • Comparative sequence analysis should include LspA from diverse bacterial phyla to identify truly conserved residues versus lineage-specific adaptations

  • Expression system selection strategy:

    • Being phylogenetically distant from common laboratory organisms, codon optimization becomes critical for successful heterologous expression

    • Consider using specialized expression hosts closer in phylogenetic relationship to green nonsulfur bacteria when feasible

    • Alternative expression strategies might include cell-free systems containing components derived from related photosynthetic bacteria

  • Functional characterization approach:

    • Substrate specificity may differ significantly from well-studied LspA enzymes

    • Native substrates should be identified through genomic analysis of P. phaeoclathratiforme lipoprotein sequences

    • Cross-species complementation assays should be interpreted cautiously due to potential differences in substrate recognition

  • Evolutionary context for inhibitor studies:

    • Inhibitor sensitivity patterns may reflect evolutionary adaptations to specific ecological niches

    • Comparative inhibition studies should include LspA from multiple phyla to establish phylogenetic patterns in inhibitor response

    • Novel inhibitor scaffolds might be identified by analyzing natural products from organisms that coexist with green nonsulfur bacteria

The phylogenetic analysis of LspA across diverse bacterial species, including P. phaeoclathratiforme, provides valuable context for understanding functional variations and can guide targeted approaches to recombinant protein production and characterization. Methodologically, this involves constructing robust phylogenetic trees using both 16S rRNA data and LspA sequence comparisons to establish evolutionary relationships that inform experimental design .

What are the critical considerations for crystallizing recombinant Pelodictyon phaeoclathratiforme LspA for structural studies?

Crystallizing membrane proteins like LspA from Pelodictyon phaeoclathratiforme presents numerous challenges that require specialized approaches. Based on successful crystallization of other bacterial LspA proteins, the following critical considerations should be addressed:

  • Protein stability optimization:

    • Thermal stability assays to identify optimal buffer conditions

    • Screening detergent/lipid combinations that maintain native conformation

    • Addition of substrate analogs or inhibitors (like globomycin) to stabilize specific conformations

    • Limited proteolysis to identify and remove flexible regions that hinder crystallization

  • Crystallization strategy selection:

    • Vapor diffusion methods with specialized membrane protein screens

    • Lipidic cubic phase (LCP) crystallization, which often succeeds for membrane proteins where traditional methods fail

    • Bicelle crystallization combining aspects of detergent and lipid-based approaches

    • Automated nanoliter-scale crystallization trials to efficiently screen conditions

  • Construct engineering approaches:

    • Creation of multiple constructs with varying N- and C-terminal boundaries

    • Insertion of crystallization chaperones (e.g., T4 lysozyme, BRIL) into loop regions

    • Surface entropy reduction through mutation of flexible, charged residues

    • Antibody fragment (Fab/nanobody) co-crystallization to provide additional crystal contacts

  • Detergent considerations:

    • Systematic screening of detergent types (maltoside, glucoside, neopentyl glycol classes)

    • Testing mixed detergent systems and detergent-lipid mixtures

    • Detergent concentration optimization to minimize free micelles while maintaining protein solubility

    • Consideration of native lipid environment components from chlorosome membranes

  • Data collection and processing strategies:

    • Microcrystal approaches using X-ray free-electron laser sources if traditional crystals prove challenging

    • Helical reconstruction cryo-EM as an alternative if crystallization proves intractable

    • Specialized data processing for potentially anisotropic diffraction patterns common in membrane protein crystals

Crystallization ParameterPotential Optimization StrategyRationale
Temperature4°C and 20°C parallel screeningDifferent temperatures favor different crystal forms
AdditivesDivalent cations (Ca²⁺, Mg²⁺)Stabilize protein-protein interfaces
Lipid supplementationNative chlorosome lipidsMimic native membrane environment
Inhibitor complexesGlobomycin, myxovirescinStabilize enzyme in defined conformational state
Protein concentration5-15 mg/mL rangeHigher concentration for LCP, lower for vapor diffusion

The successful crystallization strategy would likely combine multiple approaches tailored to the specific properties of P. phaeoclathratiforme LspA, potentially revealed through preliminary biophysical characterization studies.

How can site-directed mutagenesis be optimally designed to probe catalytic mechanism of Pelodictyon phaeoclathratiforme LspA?

Site-directed mutagenesis represents a powerful approach to investigate the catalytic mechanism of Pelodictyon phaeoclathratiforme LspA. Based on structural and mechanistic knowledge of related LspA enzymes, the following comprehensive mutagenesis strategy is recommended:

  • Catalytic residue identification and mutation plan:

    • Target conserved aspartate residues likely forming the catalytic site

    • Create conservative mutations (D→N) to maintain structure while eliminating catalytic function

    • Design non-conservative mutations (D→A) to assess structural contributions

    • Generate double and triple mutants to evaluate potential synergistic effects

  • Substrate binding pocket analysis:

    • Identify residues lining the predicted substrate binding pocket through homology modeling

    • Create mutations altering pocket hydrophobicity, size, and charge

    • Design chimeric constructs swapping binding pocket regions with those from other species

  • Transmembrane domain investigation:

    • Mutate residues at membrane interfaces to probe membrane topology

    • Create tryptophan scanning mutations across predicted transmembrane helices

    • Design cysteine pairs for disulfide cross-linking studies to validate structural models

  • Systematic mutagenesis protocol:

    • Use overlap extension PCR or commercial site-directed mutagenesis kits

    • Verify all mutations by DNA sequencing before expression

    • Express all mutants in parallel under identical conditions

    • Purify using standardized protocols to ensure comparable protein quality

    • Assess protein folding through circular dichroism and thermal stability assays

  • Functional characterization methodology:

    • Determine kinetic parameters (kcat, Km) for each mutant using FRET-based assays

    • Analyze changes in substrate specificity through varied lipopeptide substrates

    • Test inhibitor sensitivity profiles across mutant collection

    • Perform complementation assays in LspA-depleted bacterial systems

The complete mutational analysis would generate a functional map of P. phaeoclathratiforme LspA, identifying residues critical for:

  • Catalysis

  • Substrate recognition

  • Membrane integration

  • Protein stability

  • Inhibitor binding

This comprehensive approach would elucidate the unique features of LspA from photosynthetic bacteria while contributing to broader understanding of Type II signal peptidase mechanisms across bacterial diversity.

What are the best approaches for identifying natural substrates of Pelodictyon phaeoclathratiforme LspA?

Identifying the natural substrates of Pelodictyon phaeoclathratiforme LspA requires a multi-faceted approach that combines bioinformatics, proteomics, and functional validation. The following methodological strategy would be most effective:

  • Genomic and bioinformatic analysis:

    • Search the P. phaeoclathratiforme genome for proteins containing lipobox motifs ([LVI][ASTVI][GAS][C])

    • Utilize specialized lipoprotein prediction tools (LipoP, PRED-LIPO) optimized for diverse bacterial phyla

    • Perform comparative genomics with related green nonsulfur bacteria to identify conserved lipoprotein families

    • Analyze signal peptide characteristics specific to green nonsulfur bacterial lipoproteins

  • Proteomics approach:

    • Fractionate P. phaeoclathratiforme cells to separate membrane compartments

    • Perform Triton X-114 phase separation to enrich lipoproteins

    • Use mass spectrometry with N-terminal modification detection to identify lipidated proteins

    • Compare proteomes of wild-type cells versus those treated with sub-inhibitory concentrations of LspA inhibitors

  • Metabolic labeling strategy:

    • Incorporate azide-modified fatty acids for click chemistry labeling of lipoproteins

    • Use pulse-chase radiolabeling with [³H]palmitate to track lipoprotein processing

    • Perform comparative analysis between normal conditions and LspA inhibition

  • In vitro processing validation:

    • Clone and express candidate prolipoproteins identified through bioinformatics

    • Develop a gel-shift assay using recombinant P. phaeoclathratiforme Lgt and LspA

    • Assess processing efficiency across candidate substrates

    • Identify sequence determinants of substrate specificity

  • Functional characterization of identified lipoproteins:

    • Generate knockout mutants of identified lipoproteins in P. phaeoclathratiforme

    • Assess phenotypic changes, particularly in chlorosome structure and function

    • Perform protein-protein interaction studies to identify lipoprotein functional networks

    • Localize identified lipoproteins using immunogold electron microscopy

This comprehensive substrate identification approach would reveal which lipoproteins are processed by LspA in P. phaeoclathratiforme and how these proteins contribute to the unique physiology of this photosynthetic bacterium, particularly focusing on potential roles in chlorosome structure and function .

How do temperature and pH optima of Pelodictyon phaeoclathratiforme LspA compare with LspA from mesophilic pathogens?

The temperature and pH optima of enzymes often reflect adaptations to their native environments. For Pelodictyon phaeoclathratiforme LspA, these parameters would likely differ from those of mesophilic pathogenic bacteria due to their distinct ecological niches. A systematic comparative analysis would include:

  • Temperature dependence analysis methodology:

    • Perform standard FRET-based LspA assays across temperature range (4-60°C)

    • Determine temperature optima through Arrhenius plots

    • Calculate activation energies for catalysis

    • Assess thermal stability using differential scanning fluorimetry

Predicted ParameterP. phaeoclathratiforme LspAMesophilic Pathogen LspA (e.g., S. aureus)Explanation
Temperature optimumPotentially lower (20-30°C)Typically 37°C Reflects adaptation to environmental vs. host-associated lifestyle
Thermal stabilityModerateHigherPathogens often face fever temperatures requiring more stable enzymes
Cold activityHigherLowerEnvironmental bacteria must function at variable temperatures
Activation energyLowerHigherEnvironmental adaptation often selects for more flexible active sites
  • pH profile characterization:

    • Measure activity across pH range (5.0-9.0) using appropriate buffer systems

    • Determine pH stability profiles through pre-incubation experiments

    • Analyze pH-dependent changes in kinetic parameters (kcat, Km)

    • Identify key ionizable residues through pH-dependent activity of mutant variants

  • Buffer composition effects:

    • Assess activity in various ionic strength conditions

    • Determine divalent cation requirements or inhibition profiles

    • Compare detergent optima between photosynthetic and pathogenic bacterial LspA

    • Evaluate effects of membrane mimetics on pH and temperature profiles

  • Structural basis of adaptation:

    • Analyze amino acid composition changes associated with environmental adaptation

    • Identify substitutions at key positions that may contribute to altered pH/temperature profiles

    • Perform molecular dynamics simulations under varying conditions to predict structural flexibility

  • Functional consequences:

    • Correlate enzyme optima with ecological niche characteristics

    • Assess potential for activity under extreme conditions (freeze-thaw cycles, pH fluctuations)

    • Determine implications for in vitro experimental designs when working with recombinant enzyme

This comparative approach would not only characterize the biochemical properties of P. phaeoclathratiforme LspA but would also provide insights into how environmental versus pathogenic lifestyles shape enzyme evolution and adaptation. The results would inform optimal experimental conditions for working with this enzyme while contributing to broader understanding of enzyme adaptation in diverse bacterial lineages.

What are the most promising future research directions for Pelodictyon phaeoclathratiforme LspA studies?

The exploration of recombinant Pelodictyon phaeoclathratiforme lipoprotein signal peptidase (LspA) opens several promising research avenues that bridge fundamental biochemistry, evolutionary biology, and potential biotechnological applications. The most promising future research directions include:

  • Comparative structural biology:

    • Determination of the three-dimensional structure of P. phaeoclathratiforme LspA to compare with structures from pathogenic bacteria

    • Investigation of structural adaptations associated with photosynthetic bacterial membranes

    • Analysis of how structural differences influence substrate specificity and inhibitor binding

  • Photosynthesis-specific lipoprotein processing:

    • Characterization of lipoproteins specifically involved in chlorosome organization and function

    • Investigation of how lipoprotein processing influences energy transfer in photosynthetic pathways

    • Exploration of potential regulatory mechanisms linking lipoprotein processing to light adaptation

  • Evolutionary adaptation studies:

    • Analysis of LspA sequence and functional divergence across bacterial phyla

    • Investigation of how environmental versus host-associated lifestyles shape enzyme properties

    • Exploration of horizontal gene transfer patterns in lipoprotein processing systems

  • Biotechnological applications:

    • Development of expression systems optimized for membrane proteins from green nonsulfur bacteria

    • Exploration of P. phaeoclathratiforme LspA as a potential tool for recombinant lipoprotein production

    • Investigation of unique inhibitor profiles for potential selective targeting applications

  • Ecological significance:

    • Analysis of how lipoprotein processing contributes to adaptation in extreme environments

    • Investigation of interspecies interactions mediated by lipoproteins in bacterial communities

    • Exploration of the role of processed lipoproteins in biofilm formation and community structure

These research directions would not only advance our understanding of this specific enzyme but would also contribute to broader knowledge about bacterial adaptation, membrane protein evolution, and the specialized functions of lipoproteins in diverse bacterial physiologies. The photosynthetic nature of Pelodictyon phaeoclathratiforme makes its LspA particularly valuable for comparative studies with the more extensively characterized enzymes from pathogenic species, potentially revealing novel insights into the adaptation of core cellular machinery across diverse ecological niches.

What standardized protocols should be established for consistent research on recombinant Pelodictyon phaeoclathratiforme LspA?

To facilitate reproducible and comparable research on recombinant Pelodictyon phaeoclathratiforme LspA, the following standardized protocols should be established:

  • Gene synthesis and expression construct preparation:

    • Standardized codon optimization for E. coli expression

    • Uniform cloning sites and affinity tags (preferably C-terminal His6)

    • Inclusion of TEV protease cleavage sites for tag removal

    • Standard sequencing verification procedures

  • Expression protocol:

    • Defined expression strain (E. coli C41(DE3) or equivalent)

    • Standardized media composition (e.g., Terrific Broth with supplements)

    • Induction parameters: 0.5 mM IPTG at OD600 = 0.6-0.8, 20°C for 16-18 hours

    • Harvest and storage conditions (-80°C after flash freezing)

  • Membrane preparation and protein extraction:

    • Cell lysis by pressure homogenization (15,000 psi, 2-3 passes)

    • Membrane isolation by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilization in defined detergent (0.5-1% LMNG) for 2 hours at 4°C

    • Removal of insoluble material by centrifugation (100,000 × g, 30 min)

  • Purification procedure:

    • IMAC capture: Ni-NTA, defined binding and washing buffers

    • SEC polishing: Superdex 200, standard buffer composition

    • Quality control: SDS-PAGE, Western blot, mass spectrometry

    • Concentration determination by standardized methods (BCA assay with BSA standard)

  • Activity assay standardization:

    • Defined FRET substrate composition based on P. phaeoclathratiforme lipoprotein sequences

    • Standard reaction conditions: 37°C, pH 7.5, 150 mM NaCl, 0.01% LMNG

    • Fluorescence measurement parameters: Ex/Em 320/420 nm, readings every 30 seconds for 30 minutes

    • Data analysis: initial velocity calculation from linear portion of progress curve

  • Inhibition assay protocol:

    • Standard inhibitor preparation and storage conditions

    • Dose-response measurements with 10-point dilution series

    • IC50 determination using standardized curve fitting

    • Reporting conventions for inhibition constants

  • Structural analysis preparation:

    • Sample requirements for various structural techniques (X-ray, cryo-EM, NMR)

    • Standard buffer conditions for structural studies

    • Reporting format for structural data and model validation statistics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.