Recombinant Pelodictyon phaeoclathratiforme NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs

In Stock

Cat. No.

BT2494017

Source

in vitro E.coli expression system

Synonyms

nuoA; Ppha_1873; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1

Quick Inquiry

Description

General Function of NADH-quinone Oxidoreductase Subunit A

NADH-quinone oxidoreductase subunit A, encoded by the nuoA gene, is a component of the NADH dehydrogenase complex (Complex I) in bacteria. This complex is responsible for transferring electrons from NADH to quinones in the respiratory chain, generating a proton gradient across the membrane that drives ATP synthesis . The subunit A is typically embedded in the inner membrane and contributes to the proton pumping activity of the complex.

Characteristics of Pelodictyon phaeoclathratiforme

Pelodictyon phaeoclathratiforme is a brown-colored member of the Chlorobiaceae family, characterized by its net-like colonies and the presence of gas vacuoles. It is strictly anaerobic and phototrophic, using sulfide, sulfur, and thiosulfate as electron donors during anaerobic phototrophic growth . While there is no specific information on the recombinant nuoA from this species, understanding its native metabolism can provide insights into potential applications of recombinant proteins.

Table: Comparison of NADH-quinone Oxidoreductase Subunit A Functions

Feature	General Function in Bacteria	Specific to Pelodictyon phaeoclathratiforme
Electron Transfer	Transfers electrons from NADH to quinones	Limited specific data available
Proton Pumping	Generates proton gradient across the membrane	Not specifically studied in P. phaeoclathratiforme
Metabolic Role	Essential for respiratory chain function	Important in anaerobic phototrophic metabolism
Expression and Purification	Typically expressed in host organisms like E. coli	Not reported for recombinant nuoA from P. phaeoclathratiforme

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time

Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.

Shelf Life

Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms

nuoA; Ppha_1873; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-143

Protein Length

full length protein

Species

Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)

Target Names

nuoA

Target Protein Sequence

MDQTLSNFGNVFAFLALGVVFVAGGYLTARMLRPSRPNPAKNSTYECGEEAVGSAWVKFN IRFYVVALIFIIFDVEVVFLYPWATVFKQLGEFALIEALVFAGILVLGLAYAWVKGDLDW VRPTPNIPKMPEMPSGKSGALRG

Uniprot No.

B4SBZ3

Target Background

Function

Pelodictyon phaeoclathratiforme NADH-quinone oxidoreductase subunit A (nuoA) is a vital component of the respiratory chain. It facilitates electron transfer from NADH to quinones via FMN and iron-sulfur (Fe-S) centers. In this organism, the primary electron acceptor is believed to be a menaquinone. This process couples the redox reaction with proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy in a proton gradient.

Database Links

KEGG: pph:Ppha_1873

STRING: 324925.Ppha_1873

Protein Families

Complex I subunit 3 family

Subcellular Location

Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Pelodictyon phaeoclathratiforme NADH-quinone oxidoreductase subunit A (nuoA)

Description

General Function of NADH-quinone Oxidoreductase Subunit A

Characteristics of Pelodictyon phaeoclathratiforme

Table: Comparison of NADH-quinone Oxidoreductase Subunit A Functions

Product Specs

Target Background

Quick Inquiry

Category

Service