Recombinant Pelodictyon phaeoclathratiforme Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pelodictyon phaeoclathratiforme HtpX

Recombinant HtpX is a full-length, His-tagged metalloprotease expressed in E. coli. Key specifications include:

PropertyDetails
Source OrganismPelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
UniProt IDB4SCH3
Expression SystemE. coli
TagHis tag (position determined during production)
Protein Length1–291 amino acids
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C .

This recombinant protein is used in ELISA assays to study protease activity, substrate specificity, and interactions .

Domain Architecture

HtpX belongs to the M48 family of zinc-dependent metalloproteases and shares structural homology with HtrA-family proteins . Key features include:

  • Proteolytic domain: A chymotrypsin-like fold with a zinc-binding active site .

  • Transmembrane region: Anchors the protein to the cytoplasmic membrane .

  • Regulatory motifs: PDZ domains (in some homologs) for substrate recognition .

Catalytic Mechanism

HtpX requires Zn²⁺ for activity, as demonstrated by in vitro assays using refolded protein . Its proteolytic activity is enhanced under stress conditions (e.g., heat or misfolded proteins) .

Biological Role in Bacterial Systems

HtpX homologs are critical for maintaining membrane protein homeostasis:

  • Quality control: Degrades misfolded membrane proteins (e.g., SecY in E. coli) in collaboration with ATP-dependent proteases like FtsH .

  • Stress response: Activated under envelope stress to clear cytotoxic protein aggregates .

  • Antibiotic resistance: In Stenotrophomonas maltophilia, HtpX contributes to intrinsic aminoglycoside resistance by alleviating protein misfolding stress .

Key Studies on HtpX Homologs

Study FocusFindingsSource
Protease Activity AssayDeveloped an in vivo assay using engineered substrates to quantify HtpX activity in E. coli .
Antibiotic ResistanceΔhtpX mutants showed 4- to 16-fold increased susceptibility to aminoglycosides .
Substrate SpecificityCleaves SecY, a membrane protein, confirming its role in quality control .

Industrial and Biotechnological Relevance

  • Drug target potential: HtpX is a candidate for adjuvant therapies to counteract antibiotic resistance .

  • Protein engineering: Used to study zinc metalloprotease mechanics and allosteric regulation .

Comparative Analysis with Homologs

FeatureP. phaeoclathratiforme HtpXE. coli HtpX
Protein Length291 residues287 residues
Zn²⁺ DependencyYesYes
Membrane LocalizationCytoplasmic membraneCytoplasmic membrane
Role in Stress ResponseConfirmed Confirmed

Future Directions

  • Structural studies: Cryo-EM or crystallography to resolve full-length HtpX architecture.

  • Mechanistic insights: Elucidate how HtpX collaborates with FtsH in protein degradation .

  • Therapeutic exploration: Screen for HtpX inhibitors to enhance antibiotic efficacy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development during the manufacturing process.
Synonyms
htpX; Ppha_1962; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Target Names
htpX
Target Protein Sequence
MKRVILFLLTNFAVMLVLSVTARILGVDRFLTSNGLNMGMLLVFAALIGFGGSFISLLMS KTMAKWSTGAQVIKQPSSQEEVWLVETVRRLSTKAGFAMPEVAIYDGAPNAFATGPSKSR SLVAVSTGLLHSMDRKQVEAVLAHEVSHINNGDMVTLTLIQGVLNTFVIFLSRIIAYAVD SFLRRDEDESGSPGIGYWISSIACEILFGILASIVVMFFSRKREYRADAGAAALMGDRRP MIDALRALGNLDAGQLPKEMAASGIAGGGMMALFSSHPPLESRIAALESAR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pelodictyon phaeoclathratiforme and what makes it unique among green sulfur bacteria?

Pelodictyon phaeoclathratiforme is a brown-colored member of the Chlorobiaceae family isolated from the monimolimnion of Buchensee (near Radolfzell, Lake Constance region). It forms distinctive net-like colonies through ternary fission of rod-shaped, non-motile cells that contain gas vacuoles. Unlike green-colored species in this family, P. phaeoclathratiforme contains bacteriochlorophyll e and the carotenoids isorenieratene and β-isorenieratene as its major photosynthetic pigments . The organism is strictly anaerobic and obligately phototrophic, using sulfide, sulfur, and thiosulfate as electron donors during anaerobic phototrophic growth while utilizing carbon dioxide, acetate, and propionate as carbon sources under mixotrophic conditions in light .

How does the taxonomy of Pelodictyon phaeoclathratiforme relate to other Chlorobiaceae members?

P. phaeoclathratiforme represents a distinct species within the Pelodictyon genus, differentiated from the green-colored Pelodictyon clathratiforme primarily by its photosynthetic pigment composition. While morphologically and physiologically similar to other members of the family, its unique combination of gas vacuoles, net-like colony formation, and a guanine plus cytosine content of 47.9 mol% G+C establishes it as a separate species (P. phaeoclathratiforme sp. nov.) . In the broader context of green sulfur bacteria, it belongs to a pattern where most genera contain pairs of brown and green-colored species with similar morphological and physiological characteristics but different photosynthetic pigment profiles.

What is the general function of HtpX proteases in bacteria?

HtpX is typically a membrane-bound zinc metalloprotease involved in protein quality control systems within bacterial cells. While the search results don't specifically address the HtpX homolog in P. phaeoclathratiforme, bacterial HtpX proteases generally function in degrading misfolded or damaged membrane proteins, particularly under stress conditions. They work in conjunction with other quality control proteases to maintain cellular protein homeostasis and can be critical for adaptation to environmental stressors in many bacterial species.

What are the key considerations for designing experiments to study recombinant P. phaeoclathratiforme HtpX?

When designing experiments to study the recombinant HtpX protease from P. phaeoclathratiforme, researchers should consider:

  • Experimental replication strategy: Based on analysis of microscopy experiments, increasing the number of independent experiments yields more significant improvements in statistical confidence than increasing fields of view (FOV) within each experiment . For example, performing three independent experiments with fewer FOVs provides better statistical power than a single experiment with many FOVs.

  • Growth conditions: As P. phaeoclathratiforme is strictly anaerobic and phototropic, any expression system must account for these specialized growth requirements or employ heterologous expression systems.

  • Temporal dynamics: When monitoring protein production or activity, temporal resolution is critical. Statistical analysis of time-lapse data suggests that the optimal sampling frequency depends on the growth phase, with higher variability typically observed during lag phase compared to exponential growth .

  • Environmental controls: Maintaining consistent temperature (37°C), appropriate gas composition (e.g., 5% CO₂, 20% O₂), and humidity (50%) is essential for reproducible results in microbiological studies .

How should researchers optimize heterologous expression systems for recombinant P. phaeoclathratiforme HtpX?

For optimal heterologous expression of P. phaeoclathratiforme HtpX:

  • Expression host selection: Consider hosts compatible with membrane protein expression since HtpX is typically membrane-bound. E. coli strains optimized for membrane proteins or eukaryotic systems like Pichia pastoris may be appropriate.

  • Codon optimization: The G+C content of P. phaeoclathratiforme (47.9 mol%) should inform codon optimization strategies for the selected expression host.

  • Expression vector design: Include appropriate tags (His, FLAG, etc.) for purification and detection while considering their potential impact on protein folding and activity.

  • Induction conditions: Optimize temperature, inducer concentration, and duration based on pilot experiments with at least three independent biological replicates to account for variability .

  • Solubilization strategies: Test various detergents and membrane-mimicking systems (nanodiscs, liposomes) to maintain the native structure of this membrane-associated protease.

What imaging techniques are most effective for studying the localization and function of recombinant HtpX in bacterial systems?

Based on analysis of advanced imaging methodologies:

  • Confocal Laser Scanning Microscopy (CLSM): This technique allows non-invasive, real-time visualization of protein localization. For recombinant HtpX studies, experimental designs should include:

    • 3-6 independent experiments with 1-2 fields of view each (as increasing experiments provides greater statistical power than increasing fields of view)

    • Image acquisition at 10 frames per hour during exponential growth phase

    • Z-stack collection (12-20 μm with 1-μm z-slices) for adequate spatial resolution

    • Appropriate environmental controls (temperature, humidity, gas composition)

  • Fluorescent tagging strategies: When designing GFP-tagged (or other fluorescent protein) HtpX constructs, consider:

    • The impact of tag location (N- or C-terminal) on membrane insertion and protein function

    • The need for flexible linkers to minimize interference with protease activity

    • Photobleaching effects during long-term imaging experiments

  • Image analysis workflow: Implementation of quantitative image analysis using software like MetaMorph for measuring protein expression levels and cellular distribution patterns, with appropriate thresholding and segmentation methods .

What are the recommended approaches for purifying active recombinant HtpX from P. phaeoclathratiforme?

For successful purification of active recombinant HtpX:

  • Initial extraction strategy:

    • Optimize membrane fraction isolation considering the anaerobic nature of P. phaeoclathratiforme

    • Test multiple detergent combinations for efficient solubilization while preserving enzymatic activity

    • Consider the addition of zinc or other cofactors during purification to maintain protease activity

  • Purification workflow:

    • Implement a multi-step purification process combining affinity chromatography (via engineered tags), ion exchange, and size exclusion steps

    • Validate each purification step with activity assays to ensure the protease remains functional

    • Maintain reducing conditions throughout purification to preserve cysteine residues often critical for metalloprotease function

  • Activity preservation:

    • Identify optimal buffer composition, pH, and temperature for long-term storage

    • Test various stabilizing agents (glycerol, specific metal ions, reducing agents)

    • Validate enzyme activity after each freeze-thaw cycle if applicable

How can researchers effectively determine substrate specificity of P. phaeoclathratiforme HtpX?

To determine substrate specificity of HtpX:

  • Candidate substrate screening:

    • Design a panel of potential peptide and protein substrates based on known substrates of HtpX homologs

    • Include membrane proteins from P. phaeoclathratiforme that might be natural substrates

    • Develop fluorescence-based assays with quenched fluorescent peptides spanning various sequence motifs

  • Validation methods:

    • Implement multiple complementary approaches including in vitro cleavage assays, in vivo degradation studies, and proteomic analyses

    • Conduct at least three independent experiments with appropriate controls to establish statistical significance

    • Perform dose-response studies with varying enzyme:substrate ratios to determine kinetic parameters

  • Bioinformatic analysis:

    • Compare substrate preferences with those of HtpX homologs from other species

    • Use sequence alignment and structural modeling to identify conserved substrate-binding regions

    • Predict potential native substrates based on the unique physiology of P. phaeoclathratiforme as an anaerobic, phototrophic bacterium

What approaches are recommended for studying the role of HtpX in stress response in P. phaeoclathratiforme?

To investigate HtpX's role in stress response:

  • Stress condition screening:

    • Test multiple stress conditions relevant to the natural environment of P. phaeoclathratiforme, including light intensity variations, temperature shifts, and sulfide concentration changes

    • Monitor HtpX expression and activity levels under each condition

    • Design experiments with appropriate temporal resolution (10+ time points per hour) during stress adaptation phases

  • Genetic approaches:

    • Develop gene knockout or knockdown systems if genetic tools are available for P. phaeoclathratiforme

    • Create point mutations in catalytic residues to generate activity-deficient variants

    • Complement with wild-type or mutant versions to validate phenotypes

  • Physiological measurements:

    • Monitor growth parameters, photosynthetic activity, and cellular morphology in wild-type versus HtpX-deficient strains under stress conditions

    • Examine the integrity of membrane protein complexes involved in photosynthesis as potential HtpX substrates

    • Assess membrane integrity and composition changes in response to stress

How should researchers approach the statistical analysis of HtpX activity data across different experimental conditions?

For robust statistical analysis of HtpX activity data:

  • Experimental design planning:

    • Power analysis should guide the number of independent experiments required

    • For detecting a significant effect with 95% confidence, plan for at least three independent experiments with replicate measurements in each

    • Consider nested experimental designs that account for variability between experiments, between replicates within experiments, and between technical measurements

  • Variance component analysis:

    • Assess sources of variability at different experimental levels (between experiments, between replicates, etc.)

    • Calculate repeatability standard deviation to understand inherent variability of the system

    • Use linear mixed effects models to account for random and fixed effects in complex experimental designs

  • Reporting results:

    • Include confidence intervals rather than just p-values

    • Report the margin of error for key measurements

    • Present both raw data and processed results in supplementary materials for transparency

What are the most common pitfalls in interpreting results from recombinant protease studies, and how can they be avoided?

Common pitfalls and their solutions include:

  • Artifact identification:

    • Non-specific proteolysis due to contaminating proteases: Include negative controls with protease inhibitors and catalytically inactive mutants

    • Tag interference with protein function: Validate results with differently tagged constructs or tag-free proteins

    • Buffer composition effects: Test activity across multiple buffer systems to distinguish genuine activity from buffer artifacts

  • Heterogeneity assessment:

    • Protein aggregation: Employ size exclusion chromatography and dynamic light scattering to verify monodispersity

    • Mixed oligomeric states: Characterize the relationship between oligomeric state and activity

    • Post-translational modifications: Verify protein homogeneity by mass spectrometry

  • Translation to in vivo relevance:

    • Artificial substrate bias: Validate in vitro findings with in vivo approaches when possible

    • Concentration effects: Test enzyme activity across physiologically relevant concentration ranges

    • Environmental context: Consider how the natural environment of P. phaeoclathratiforme (anaerobic, light-dependent) might affect protein function

What strategies can address poor expression or insolubility of recombinant P. phaeoclathratiforme HtpX?

When encountering expression or solubility issues:

  • Expression optimization:

    • Test multiple expression hosts beyond standard E. coli strains

    • Vary induction parameters (temperature, inducer concentration, duration)

    • Consider specialized vectors designed for membrane proteins

  • Solubility enhancement:

    • Screen diverse detergents systematically (non-ionic, zwitterionic, and mild ionic)

    • Test fusion partners known to enhance membrane protein solubility

    • Explore membrane-mimetic systems (nanodiscs, liposomes, amphipols)

  • Refolding approaches:

    • Develop protocols for extraction from inclusion bodies if necessary

    • Implement step-wise dialysis with decreasing denaturant concentrations

    • Include appropriate cofactors (zinc) during refolding

How can researchers troubleshoot issues with recombinant HtpX activity assays?

For activity assay troubleshooting:

  • Controls and validation:

    • Include positive controls with well-characterized proteases

    • Verify substrate quality by alternative methods (mass spectrometry, gel electrophoresis)

    • Test multiple assay formats (FRET-based, chromogenic, radiometric) to confirm results

  • Assay condition optimization:

    • Systematically vary pH, temperature, ionic strength, and cofactor concentrations

    • Consider the anaerobic nature of P. phaeoclathratiforme and test activity under reduced oxygen conditions

    • Assess time-dependent activity to ensure measurements are taken in the linear range

  • Analytical considerations:

    • Test multiple substrate concentrations to determine Km and Vmax

    • Account for potential product inhibition by analyzing initial reaction rates

    • Evaluate enzyme stability under assay conditions by pre-incubation studies

What are the most promising applications of recombinant P. phaeoclathratiforme HtpX in biotechnology and basic research?

Promising future applications include:

  • Biotechnological applications:

    • Development of novel biocatalysts for specific membrane protein processing

    • Creation of biosensors for environmental monitoring using the unique specificity of HtpX

    • Engineering of stress-resistant bacterial strains through HtpX modifications

  • Basic research opportunities:

    • Comparative studies across HtpX homologs from diverse bacterial phyla

    • Investigation of evolutionary adaptation of protein quality control systems in anaerobic phototrophs

    • Structure-function analysis to understand substrate recognition mechanisms

  • Integration with emerging technologies:

    • Application of cryo-EM for structural analysis of HtpX in membrane environments

    • Development of in vivo activity reporters using split fluorescent proteins or FRET systems

    • Implementation of high-throughput screening platforms for identifying novel substrates or inhibitors

How might studying P. phaeoclathratiforme HtpX contribute to understanding bacterial adaptation to extreme environments?

Contributions to understanding bacterial adaptation include:

  • Stress response mechanisms:

    • Insights into protein quality control systems functioning under anaerobic, phototrophic conditions

    • Understanding how membrane proteases contribute to maintaining photosynthetic machinery integrity

    • Elucidation of how strictly anaerobic bacteria manage protein homeostasis without oxygen-dependent systems

  • Evolutionary perspectives:

    • Comparative analysis of HtpX homologs across diverse bacterial phyla

    • Investigation of how protein quality control systems adapted to the unique ecological niche of green sulfur bacteria

    • Exploration of the relationship between membrane composition and protease function in anaerobic environments

  • Ecological implications:

    • Understanding the role of HtpX in bacterial survival in the monimolimnion of stratified lakes

    • Investigation of protease involvement in bacterial community formation in extreme environments

    • Analysis of how membrane protein turnover contributes to adaptation to fluctuating sulfide levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.