Recombinant Pelomedusa subrufa Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Pelomedusa subrufa (African side-necked turtle)
Target Names
Target Protein Sequence
MPTPNQTNFQDAASPLMEELTHFHDHTLMIVFMISLLVLYILLSMLSTKLTHTNTANAQQ AEMVWTILPAIILITIALPSLQILYMMDEINKPHMTIKAIGHQWYWTYEYTDYKELEFNS YMIQTQDLPLGHMRLLEVDHRMVTPLESYIRMLISADDVLHSWAIPSLGLKTDAVPGRIN QAVFIIMQAGIFYGQCSEICGANHSFMPVVVESLPMNHFDLWLAMIDTL
Uniprot No.

Target Background

Function

Pelomedusa subrufa Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme complex drives oxidative phosphorylation, a crucial process for ATP generation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, establishing an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1—a binuclear center (BNC) comprising heme A3 and copper B (CuB). The BNC uses four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Pelomedusa subrufa Cytochrome c oxidase subunit 2 and what is its biological significance?

Pelomedusa subrufa Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded protein derived from the African side-necked turtle (Pelomedusa subrufa). Also known as COII, COXII, or MTCO2, this protein functions as a critical component of Complex IV (cytochrome c oxidase) in the mitochondrial respiratory chain . Cytochrome c oxidase represents the terminal enzyme in the electron transport chain, facilitating the transfer of electrons from cytochrome c to molecular oxygen while pumping protons across the inner mitochondrial membrane. This process contributes to the generation of the proton gradient necessary for ATP synthesis. The biological significance of MT-CO2 extends beyond basic energy metabolism, as mutations in this gene have been linked to mitochondrial diseases with severe neurological manifestations .

How does Pelomedusa subrufa MT-CO2 compare to homologous proteins in other species?

Cytochrome c oxidase subunit 2 is highly conserved across species due to its essential role in cellular respiration. Research comparing MT-CO2 across species shows conservation of key functional domains, particularly those involved in copper binding and electron transfer. Studies with yeast cytochrome c oxidase have provided valuable insights into the structure-function relationship of this protein family .

In yeast models, research has demonstrated that the W56R mutation in the first transmembrane segment decreases hydrophobicity, enabling successful import of the protein into mitochondria during allotopic expression experiments . This finding suggests that specific structural requirements govern the successful integration of Cox2 into the mitochondrial membrane across species. Comparative karyotype analysis of Pelomedusa subrufa has revealed either 2n = 34 or 2n = 36 chromosomal arrangements, providing context for genomic studies of the MT-CO2 gene .

What are the optimal conditions for storing and handling recombinant Pelomedusa subrufa MT-CO2?

Recombinant Pelomedusa subrufa MT-CO2 requires specific storage and handling protocols to maintain protein stability and functionality. The protein is typically available in either liquid form or as a lyophilized powder. For optimal storage, maintain the protein at -20°C to -80°C upon receipt . When working with the lyophilized form, reconstitution should be performed using Tris/PBS-based buffer (pH 8.0) .

To preserve protein integrity, aliquoting is necessary for multiple use scenarios to avoid repeated freeze-thaw cycles that can denature the protein structure . The shelf life varies depending on storage conditions and buffer formulation: liquid preparations typically maintain integrity for approximately 6 months at -20°C/-80°C, while the lyophilized form demonstrates increased stability with a shelf life of approximately 12 months at the same temperature range .

What expression systems are most effective for producing recombinant Pelomedusa subrufa MT-CO2?

The most effective expression system documented for recombinant Pelomedusa subrufa MT-CO2 is the in vitro Escherichia coli expression system . This bacterial expression platform offers several advantages for mitochondrial protein production, including high yield, cost-effectiveness, and relative simplicity. When expressing MT-CO2, the incorporation of an N-terminal 10xHis tag facilitates subsequent purification through affinity chromatography techniques .

For researchers considering alternative expression systems, it's important to note that mitochondrial proteins like MT-CO2 present unique challenges due to their hydrophobic nature and specialized folding requirements. Studies with yeast cytochrome c oxidase suggest that modifications reducing transmembrane domain hydrophobicity may improve expression efficiency in heterologous systems . When designing expression constructs, consideration should be given to codon optimization for the host organism and the potential impact of tag placement on protein folding and function.

What analytical methods are most appropriate for assessing MT-CO2 functionality in experimental settings?

Multiple analytical approaches can be employed to assess MT-CO2 functionality, each providing distinct insights into protein activity and integration:

  • In-gel activity assays: These can detect both monomeric complex IV activity and the formation of supercomplexes with other respiratory chain components. Research with yeast cytochrome c oxidase has demonstrated the utility of this approach for distinguishing between wild-type and mutant protein functionality .

  • Oxygen consumption measurements: Direct measurement of oxygen consumption rates provides quantitative assessment of cytochrome c oxidase activity. This method enables comparison between wild-type and mutant forms of the protein under various experimental conditions .

  • Spectroscopic quantitation: This approach enables quantification of cytochromes and assessment of their redox states, providing insights into electron transfer efficiency .

  • Supercomplex formation analysis: Blue native gel electrophoresis can be used to analyze the integration of MT-CO2 into functional respiratory chain supercomplexes, including associations with complex III (the bc1 complex) .

How do mutations in MT-CO2 contribute to mitochondrial disease pathogenesis?

Mutations in MT-CO2 can significantly impair mitochondrial respiratory chain function, leading to a spectrum of clinical manifestations. A recent case study documented an undescribed variant, m.8091G>A in the MT-CO2 gene, associated with complex IV deficiency and decreased mitochondrial respiratory chain capabilities . This mutation manifested clinically as a neurodegenerative condition characterized by myopia, bilateral sensorineural hearing loss, and motor disorders .

Brain MRI findings in patients with MT-CO2 mutations have revealed major cortico-subcortical and infra-tentorial atrophies, intracerebral iron accumulation, and central calcifications. These neuroimaging features are compatible with a Neurodegeneration with Brain Iron Accumulation (NBIA)-like phenotype . The pathogenic mechanism likely involves compromised electron transport through complex IV, resulting in decreased ATP production, increased reactive oxygen species generation, and subsequent neuronal damage.

What experimental models are available for studying MT-CO2 mutations and their phenotypic consequences?

Several experimental models have proven valuable for investigating MT-CO2 mutations and their functional outcomes:

  • Yeast models: Studies using Saccharomyces cerevisiae have demonstrated that mutations in COX2 result in respiratory-incompetent phenotypes. These models allow for detailed analysis of how specific mutations affect respiratory chain assembly, activity, and supercomplex formation .

  • Allotopic expression systems: Research has established proof-of-principle that cytosol-synthesized Cox2 carrying specific mutations (such as W56R) can complement phenotypes resulting from mutant mitochondrial COX2 genes . This approach enables investigation of how specific amino acid substitutions impact protein import, processing, and functionality.

  • In-gel activity assays: These methodologies enable quantitative assessment of how mutations affect complex IV activity both as a monomeric complex and within respiratory supercomplexes .

When comparing wild-type and mutant forms, measurements of oxygen consumption rates, spectroscopic quantitation of cytochromes, and analysis of respiratory growth provide comprehensive insights into the functional consequences of MT-CO2 mutations .

How can allotopic expression of MT-CO2 be optimized for functional complementation studies?

Optimizing allotopic expression of MT-CO2 requires careful consideration of several factors based on experimental evidence from related systems:

  • Hydrophobicity modulation: Research with yeast cytochrome c oxidase demonstrates that decreasing transmembrane domain hydrophobicity through strategic mutations (such as W56R) can significantly enhance mitochondrial import of cytosolically synthesized Cox2 . The W56R mutation in the first transmembrane segment reduces mean hydrophobicity of the alpha helix, facilitating precursor import into mitochondria .

  • Import sequence optimization: For successful mitochondrial targeting, incorporation of optimized mitochondrial targeting sequences is essential for efficient translocation across mitochondrial membranes.

  • Post-import processing: Ensuring proper post-import processing is critical, as studies with allotopically expressed Cox2 W56R indicate that only a fraction undergoes complete maturation within mitochondria . This processing efficiency directly impacts the steady-state accumulation of functional cytochrome c oxidase.

  • Supercomplex formation: Evaluating the capacity of allotopically expressed MT-CO2 to participate in respiratory chain supercomplex formation is crucial, as reduced supercomplex formation has been observed with some allotopically expressed variants .

What are the key considerations for designing MT-CO2 mutation studies relevant to human mitochondrial diseases?

When designing MT-CO2 mutation studies with relevance to human mitochondrial diseases, researchers should consider:

  • Pathogenic variant selection: Focus on mutations analogous to those identified in human patients, such as the m.8091G>A variant associated with complex IV deficiency and NBIA-like phenotypes . This approach enhances translational relevance.

  • Functional domain targeting: Prioritize mutations affecting known functional domains, including copper-binding sites and transmembrane regions essential for protein integration and electron transfer.

  • Model system selection: Carefully select appropriate model systems that recapitulate key aspects of human mitochondrial biology. While yeast models offer advantages for basic mechanistic studies , mammalian cell lines or animal models may provide greater translational relevance for neurodegenerative manifestations.

  • Comprehensive phenotyping: Implement multidimensional phenotyping approaches that assess:

    • Complex IV assembly and stability

    • Electron transfer efficiency

    • Supercomplex formation

    • Reactive oxygen species production

    • Cellular bioenergetics

    • Cell-type specific vulnerabilities

  • Technical controls: Include appropriate controls such as wild-type MT-CO2 and established pathogenic mutations to contextualize experimental findings .

How can recombinant MT-CO2 be utilized in structural biology approaches to elucidate mutation effects?

Recombinant MT-CO2 presents valuable opportunities for structural biology investigations that can illuminate mutation-induced alterations in protein conformation and function:

  • Cryo-electron microscopy (cryo-EM): This approach can resolve structural details of MT-CO2 within the context of the complete cytochrome c oxidase complex, enabling visualization of how mutations disrupt protein-protein interactions or electron transfer pathways.

  • X-ray crystallography: When combined with appropriate stabilization strategies, X-ray crystallography can provide atomic-level insights into MT-CO2 structure, particularly around functional domains containing disease-associated mutations.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of altered protein dynamics or solvent accessibility resulting from specific mutations, providing insights into structural perturbations not readily apparent in static structural models.

  • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR): This approach enables measurement of distances between specific residues and detection of conformational changes induced by mutations.

  • Molecular dynamics simulations: In silico approaches can model the dynamic consequences of specific mutations, particularly those affecting transmembrane domain stability or interaction with other subunits.

How does MT-CO2 from Pelomedusa subrufa contribute to our understanding of mitochondrial evolution?

Pelomedusa subrufa represents an important taxonomic group for understanding mitochondrial gene evolution. As an African side-necked turtle with a continental distribution throughout sub-Saharan Africa , this species occupies an informative phylogenetic position for comparative mitochondrial genomics. The MT-CO2 gene from Pelomedusa subrufa can serve as a reference point for investigating the selective pressures acting on mitochondrial genes across diverse vertebrate lineages.

Karyotype analyses of Pelomedusa subrufa have reported either 2n = 34 (5 pairs of macrochromosomes and 12 pairs of microchromosomes) or 2n = 36 (5 pairs of macrochromosomes and 13 pairs of microchromosomes) . This chromosomal information provides context for understanding the genomic organization of mitochondrial genes and their nuclear counterparts.

What methodological approaches are most effective for cross-species functional analysis of MT-CO2?

For effective cross-species functional analysis of MT-CO2, researchers should consider implementing:

  • Heterologous expression systems: Utilizing yeast strains with deletions in endogenous COX2 genes provides a valuable platform for functional complementation studies with MT-CO2 variants from different species . This approach has successfully demonstrated that allotopically expressed Cox2 carrying specific mutations can restore respiratory growth in COX2-deficient yeast .

  • Chimeric protein construction: Creating chimeric proteins that combine domains from MT-CO2 across species can help identify functionally conserved regions and species-specific adaptations.

  • In-gel activity assays: These assays enable quantitative comparison of MT-CO2 function across species by measuring complex IV activity both as a monomeric complex and within respiratory supercomplexes .

  • Oxygen consumption measurements: Direct measurement of respiratory activity provides a functional readout that can be standardized across species, facilitating comparative analysis .

  • Bioinformatic approaches: Sequence analysis tools that identify conserved domains, evolutionary rates, and sites under positive selection complement experimental approaches by providing evolutionary context for observed functional differences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.