Recombinant Pelophylax nigromaculatus Tyrosinase (TYR)

Shipped with Ice Packs
In Stock

Description

Pigmentation Studies

  • Body color regulation: Used to study melanin synthesis in P. nigromaculatus, where TYR expression correlates with dark vs. light phenotypes .

    • In dark-phenotype frogs, TYR expression is 2–5× higher in skin, muscle, and eyeball tissues compared to light phenotypes .

  • Albino mutation analysis: Frameshift and missense mutations in TYR (e.g., glycine-to-arginine substitutions) disrupt melanogenesis, causing albinism .

Biochemical Assays

  • Kinetic analysis: Measures substrate specificity for L-tyrosine and L-DOPA under varying pH and temperature conditions .

  • Inhibitor screening: Identifies compounds like kojic acid and tropolone that suppress melanin production for cosmetic or agricultural use .

Comparative Sequence Analysis

Phylogenetic studies reveal high similarity (~90%) between P. nigromaculatus TYR and tyrosinases from other vertebrates, particularly Cyprinidae fish . Notable conserved regions include:

DomainFunctionConservation
Signal peptideGuides protein secretion20 residues (MRPSSISPLLFFIQYLGLSL)
Tyrosinase domainCatalytic core with CuA/CuB sites85% identity with C. carpio
Transmembrane regionMembrane anchoring12 hydrophobic residues

Industrial and Biomedical Relevance

  • Cosmetic development: TYR inhibitors derived from recombinant enzyme studies are used in skin-whitening products .

  • Food preservation: Prevents enzymatic browning in fruits by targeting TYR activity .

  • Disease modeling: Albinism-linked TYR mutations (e.g., Q04604 variants) aid in studying oculocutaneous albinism type IA .

Challenges and Future Directions

  • Instability: Recombinant TYR from P. nigromaculatus shows sensitivity to pH and temperature fluctuations, requiring glycerol stabilization .

  • Functional studies: Further structural resolution (e.g., X-ray crystallography) is needed to elucidate substrate-binding mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. If you have any particular format requirements, please indicate them when placing your order, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TYR; TYRS; Tyrosinase; Monophenol monooxygenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-532
Protein Length
Full Length of Mature Protein
Species
Pelophylax nigromaculatus (Black-spotted frog) (Rana nigromaculata)
Target Names
TYR
Target Protein Sequence
GIDGHRGGRGTHQSNIRIYSDSAPPWFTKEDISAMRFLSDSRIGHIKQNLLLFESDQTPL
Uniprot No.

Target Background

Function
This copper-containing oxidase plays a crucial role in the formation of pigments, including melanins and other polyphenolic compounds. It catalyzes the initial and rate-limiting step in the cascade of reactions leading to melanin production from tyrosine. In addition to hydroxylating tyrosine to DOPA (3,4-dihydroxyphenylalanine), it also catalyzes the oxidation of DOPA to DOPA-quinone.
Protein Families
Tyrosinase family
Subcellular Location
Melanosome membrane; Single-pass type I membrane protein.

Q&A

What is Pelophylax nigromaculatus Tyrosinase (TYR) and what is its biological significance?

Pelophylax nigromaculatus Tyrosinase (TYR) is a copper-containing enzyme responsible for catalyzing the rate-limiting step in melanin biosynthesis in the Japanese pond frog (Pelophylax nigromaculatus). This enzyme plays a critical role in pigmentation development and has become a significant model for studying albinism in amphibians. The biological significance of TYR lies in its essential function in the conversion of tyrosine to dopaquinone, which subsequently leads to the production of melanin pigments that determine skin, eye, and hair coloration in vertebrates. Mutations in the TYR gene are directly linked to oculocutaneous albinism in P. nigromaculatus, making it an excellent model for understanding pigmentation disorders across vertebrate species . Additionally, the TYR gene has proven valuable as a nuclear marker for phylogenetic studies and investigating introgression events between closely related frog species, particularly between P. nigromaculatus and P. plancyi .

What types of mutations have been identified in the TYR gene of P. nigromaculatus and how do they affect enzyme function?

Multiple spontaneous mutations in the tyrosinase gene have been identified in albino populations of P. nigromaculatus, representing the first molecular analyses of albinic phenotypes in frogs. These mutations fall into three primary categories:

  • Frameshift mutations: In albinos collected from two different populations, frameshift mutations were caused by the insertion of a thymine residue within exons 1 and 4 of the TYR gene .

  • Deletion mutations: Albinos from a third population exhibited a deletion of three nucleotides encoding a highly conserved lysine in exon 1 .

  • Splicing variants: Some albino P. nigromaculatus populations displayed splicing variants of mRNA that lacked either exons 2-4 or exon 4 .

These mutations significantly impact enzyme function by altering the protein structure or expression. The frameshift mutations likely result in premature termination of protein synthesis, producing truncated and non-functional tyrosinase. The deletion of the highly conserved lysine in exon 1 suggests this amino acid is critical for proper enzyme function, as this residue is evolutionarily conserved across vertebrates . The splicing variants result in the production of incomplete mRNA transcripts that cannot be translated into functional enzymes, leading to the absence of tyrosinase activity and consequent albinism.

How does the structure of P. nigromaculatus TYR compare to tyrosinase in other vertebrate species?

The tyrosinase structure in P. nigromaculatus shares significant homology with other vertebrate tyrosinases while exhibiting some unique features. Key structural characteristics include:

  • Conserved copper-binding domains: P. nigromaculatus TYR contains highly conserved copper-binding domains that are essential for catalytic activity. The glycine residue identified in the albino G. rugosa (a related frog species) is located within one of these predicted copper-binding domains, suggesting structural conservation of these functional regions across vertebrates .

  • Conserved amino acid residues: Certain amino acids, such as the lysine deleted in one P. nigromaculatus albino population and the glycines mutated in F. kawamurai and G. rugosa, are highly conserved across vertebrates. This conservation indicates these residues are situated in regions critical to tyrosinase function .

  • Exon organization: While the exact exon structure wasn't fully detailed in the available research, the presence of splicing variants lacking specific exons (2-4 or 4) suggests an exon organization that may parallel that of other vertebrates, with functional domains distributed across multiple exons .

The mutations identified in P. nigromaculatus TYR are unique among vertebrates, suggesting that research on this species could provide novel insights into tyrosinase structure and function that may be applicable to understanding pigmentation disorders in humans and other vertebrates .

What methodologies are most effective for expressing recombinant P. nigromaculatus TYR while maintaining enzymatic activity?

For the effective expression of recombinant P. nigromaculatus TYR with preserved enzymatic activity, researchers should consider the following methodological approaches:

  • Expression systems: Eukaryotic expression systems such as insect cells (Sf9 or High Five) using baculovirus vectors are recommended for TYR expression, as they provide post-translational modifications necessary for proper folding and activity. Mammalian expression systems (HEK293 or CHO cells) can also be effective for maintaining glycosylation patterns that may be essential for stability and activity.

  • Temperature considerations: Expression at lower temperatures (16-20°C) often enhances proper folding of complex proteins like tyrosinase, which contains multiple disulfide bonds and requires copper incorporation.

  • Copper supplementation: Since tyrosinase is a copper-dependent enzyme, supplementing the expression medium with copper ions (typically CuSO₄ at 10-100 μM) is crucial for obtaining catalytically active enzyme.

  • Codon optimization: Adapting the P. nigromaculatus TYR codon usage to the expression host can significantly improve translation efficiency and protein yield.

  • Signal peptide modification: Replacing the native signal peptide with one optimized for the expression system can enhance secretion and proper processing of the recombinant protein.

When purifying the recombinant enzyme, gentle methods that preserve the copper-binding sites should be employed, often using affinity tags positioned to minimize interference with the catalytic domains. Inclusion of stabilizing agents such as glycerol (10-20%) and reducing agents at low concentrations can help maintain enzymatic activity during storage. These methodological considerations are particularly important given the observation that specific amino acid residues in P. nigromaculatus TYR are critical for maintaining function, as evidenced by the albino phenotypes resulting from their mutation .

How can recombinant P. nigromaculatus TYR be used to study evolutionary relationships among frog species?

Recombinant P. nigromaculatus TYR and its gene sequences serve as valuable tools for studying evolutionary relationships among frog species through several approaches:

  • Nuclear marker for phylogenetic reconstruction: The TYR gene provides important phylogenetic information complementary to mitochondrial markers. In studies of Pelophylax species, TYR gene sequences have been instrumental in distinguishing between P. nigromaculatus and P. plancyi, resolving their evolutionary relationships even when mitochondrial data presented conflicting signals .

  • Detection of hybridization events: Recombinant TYR expression and sequencing can identify potential hybrid individuals. For example, heterozygosity at polymorphic sites between species can indicate hybridization, as was observed in one individual (CNU5268) that appeared to be an F₁ hybrid between P. plancyi and P. nigromaculatus .

  • Analysis of sequence polymorphisms: Fixed differences in the TYR gene between species can be identified, providing diagnostic markers for species identification. Studies have found several fixed differences between P. nigromaculatus, P. plancyi, and P. fukienensis clades .

  • Comparison with mitochondrial data: By comparing nuclear TYR gene trees with mitochondrial gene trees, researchers can identify introgression events and distinguish them from incomplete lineage sorting. This approach revealed historical mitochondrial introgression between P. nigromaculatus and P. plancyi despite clear separation in nuclear genes .

  • Temporal calibration: When combined with fossil data or other calibration points, TYR sequence divergence can contribute to estimating divergence times between lineages, providing a timeframe for evolutionary events.

The utility of TYR for evolutionary studies is exemplified by research that used both nuclear genes (including TYR) and mitochondrial data to discover multiple introgression events between closely related frog species, revealing a complex evolutionary history that would not have been detectable using mitochondrial data alone .

What are the most significant challenges in expressing and purifying active recombinant P. nigromaculatus TYR?

The expression and purification of active recombinant P. nigromaculatus TYR presents several significant challenges that researchers must address:

  • Maintaining copper incorporation: Tyrosinase is a copper-dependent enzyme, and proper incorporation of copper ions into the active site is essential for catalytic activity. Environmental conditions during expression and purification can affect copper binding, potentially resulting in inactive enzyme.

  • Preventing protein aggregation: Tyrosinase has a tendency to form aggregates, particularly when overexpressed. This aggregation can lead to inclusion body formation in bacterial expression systems, necessitating refolding procedures that may yield low recovery of active enzyme.

  • Preserving tertiary structure: The critical importance of conserved amino acids in P. nigromaculatus TYR, such as the glycine located within a predicted copper-binding domain in related species, indicates that maintaining proper tertiary structure is crucial for activity . Purification conditions must be carefully optimized to preserve these structural elements.

  • Managing oxidation sensitivity: Tyrosinase contains multiple cysteine residues that can form disulfide bonds critical for proper folding. These residues are susceptible to oxidation during purification, potentially compromising enzyme activity.

  • Addressing glycosylation requirements: If P. nigromaculatus TYR requires specific glycosylation patterns for stability or activity, expression systems that can perform appropriate post-translational modifications must be selected.

  • Developing activity assays: Establishing reliable assays to monitor enzymatic activity throughout the purification process is essential for evaluating the success of different purification strategies.

  • Preventing substrate-induced inactivation: During activity assays, tyrosinase can be inactivated by reaction with its own quinone products, complicating the assessment of purification efficiency.

Addressing these challenges requires careful selection of expression systems, optimization of growth conditions, and development of purification protocols that minimize exposure to conditions that might compromise the enzyme's structure or copper content.

How do mutations in copper-binding domains affect the catalytic activity of P. nigromaculatus TYR?

Mutations in copper-binding domains have profound effects on the catalytic activity of P. nigromaculatus TYR, as these regions are essential for the enzyme's function:

The study of these naturally occurring mutations provides valuable insights into structure-function relationships in tyrosinase and could inform directed engineering efforts to modify enzyme properties for research or biotechnological applications.

What methodological approaches can distinguish between introgression and incomplete lineage sorting when analyzing TYR gene data?

Distinguishing between introgression and incomplete lineage sorting (ILS) when analyzing TYR gene data requires a multi-faceted methodological approach:

  • Comparative phylogenomic analysis: Comparing patterns from multiple independent nuclear loci, including TYR, with mitochondrial gene trees can reveal discordant evolutionary histories. In the case of P. nigromaculatus and P. plancyi, nuclear genes (including TYR) showed clear species separation while mitochondrial genes showed intertwined patterns, strongly supporting introgression rather than ILS .

  • Coalescence time estimation: Mitochondrial genes typically coalesce four times faster than nuclear genes due to their maternal inheritance and haploid nature. When mitochondrial patterns conflict with multiple nuclear genes (as observed with TYR and POMC genes), introgression is more likely than ILS .

  • Geographic distribution analysis: Mapping the distribution of haplotypes across geographic regions can provide evidence for introgression events. Spatial patterns consistent with geographic proximity of different species support introgression scenarios.

  • Statistical modeling: Implementing statistical frameworks such as Approximate Bayesian Computation (ABC) or PhyloNet can formally test alternative hypotheses of introgression versus ILS by estimating the likelihood of observed gene tree discordances under different evolutionary scenarios.

  • Fixed differences analysis: Examining fixed genetic differences between species across the TYR gene can identify diagnostic sites. The presence of these fixed differences in nuclear genes despite mitochondrial sharing supports introgression over ILS .

  • Identification of hybrid individuals: Direct evidence for ongoing hybridization, such as the F₁ hybrid (CNU5268) identified between P. plancyi and P. nigromaculatus that showed heterozygosity at all polymorphic sites between the two species, strongly supports the introgression hypothesis .

  • Temporal pattern analysis: Estimating the timing of divergence events can help distinguish ancient introgression from ILS. The identification of an ancient "forward" introgression event (estimated at 1.36 MYA) followed by recent "backward" introgression events between P. nigromaculatus and P. plancyi exemplifies how temporal data can clarify complex evolutionary histories .

The combination of these approaches provides a robust framework for distinguishing between introgression and ILS, as demonstrated in the study of Pelophylax species where multiple lines of evidence supported the multiple mitochondrial genome introgression hypothesis .

How can site-directed mutagenesis of P. nigromaculatus TYR inform our understanding of albinism in vertebrates?

Site-directed mutagenesis of P. nigromaculatus TYR provides an invaluable experimental approach to understanding the molecular basis of albinism in vertebrates:

  • Targeted recreation of natural mutations: By recreating the spontaneous mutations identified in albino P. nigromaculatus (frameshift mutations in exons 1 and 4, deletion of lysine in exon 1, and missense mutations causing glycine to arginine/aspartic acid substitutions), researchers can directly confirm their causative role in albinism .

  • Structure-function relationship analysis: Introducing systematic mutations in copper-binding domains and other conserved regions can elucidate which amino acid residues are critical for enzyme function. The observation that glycine in G. rugosa is located within a predicted copper-binding domain suggests that studying such positions could reveal key functional requirements .

  • Comparative mutation analysis: Creating equivalent mutations found in human tyrosinase in the P. nigromaculatus enzyme can reveal whether the functional effects are conserved across species, potentially informing the understanding of human albinism.

  • Splicing variant investigation: Engineering constructs that reproduce the splicing variants observed in albino P. nigromaculatus (lacking exons 2-4 or exon 4) can help identify the regulatory elements controlling proper splicing and the functional consequences of exon skipping .

  • Rescue experiments: Expressing wild-type recombinant P. nigromaculatus TYR in melanocytes from albino frogs could confirm whether the introduced functional enzyme restores melanin production, validating the causal relationship between specific mutations and the albino phenotype.

  • Cross-species complementation: Testing whether P. nigromaculatus TYR can functionally substitute for tyrosinase in other vertebrate systems with known mutations provides insight into the conservation of enzymatic mechanisms across species.

These approaches can generate new information about tyrosinase structure and transcript processing, contributing to research on albinism in humans and other vertebrates by providing insights that may not be obtainable from studying mammalian systems alone .

What computational approaches are most effective for predicting the functional impact of TYR mutations?

Predicting the functional impact of TYR mutations requires a multifaceted computational approach combining several complementary methods:

  • Sequence conservation analysis: Tools that analyze evolutionary conservation, such as ConSurf or Clustal Omega, can identify highly conserved residues across vertebrates. The lysine deleted in one P. nigromaculatus albino and the glycines mutated in F. kawamurai and G. rugosa were identified as highly conserved in vertebrates, correctly predicting their functional importance .

  • Structural modeling: Homology modeling using related crystallized tyrosinases as templates can predict the three-dimensional structure of P. nigromaculatus TYR. Programs like SWISS-MODEL, Phyre2, or AlphaFold can generate structural models to visualize how mutations might affect copper-binding domains or substrate interactions.

  • Molecular dynamics simulations: Software such as GROMACS or AMBER can simulate the dynamic behavior of both wild-type and mutant TYR proteins, revealing how mutations alter protein flexibility, stability, and interactions with substrates or copper ions.

  • Machine learning approaches: Algorithms trained on known disease-causing mutations, such as SIFT, PolyPhen-2, or MutPred, can predict whether novel mutations are likely to be deleterious. These tools would be particularly valuable for assessing the potential impact of the glycine substitutions observed in related frog species .

  • Splicing prediction tools: For mutations potentially affecting splicing, programs like Human Splicing Finder or SpliceAI can predict how sequence changes might alter exon recognition and splicing patterns, relevant to the observed splicing variants lacking exons 2-4 or exon 4 in P. nigromaculatus .

  • Protein stability prediction: Tools such as FoldX or I-Mutant can estimate changes in protein stability (ΔΔG) resulting from amino acid substitutions, helping to predict whether mutations lead to protein destabilization.

  • Integration of multiple predictors: Meta-predictors like CADD, REVEL, or Meta-SNP combine results from multiple individual prediction tools to provide more robust functional predictions.

The effectiveness of these computational approaches has been demonstrated by their ability to identify structurally and functionally critical regions in tyrosinase, such as the copper-binding domains where mutations are known to cause albinism in frogs and other vertebrates .

How can TYR gene sequences be effectively employed in phylogenetic studies of Pelophylax species?

TYR gene sequences provide valuable data for phylogenetic studies of Pelophylax species through several methodological approaches:

  • Nuclear marker complementarity: As a nuclear gene, TYR provides independent evolutionary information that complements mitochondrial data. This complementarity was crucial in identifying mitochondrial introgression between P. nigromaculatus and P. plancyi, as TYR gene trees clearly separated the two species while mitochondrial genes showed intertwining patterns .

  • Selection of analytical methods: For TYR sequence analysis, both Bayesian inference and maximum parsimony methods have proven effective. In studies of Pelophylax species, parsimony analysis of TYR sequences provided better-resolved trees than Bayesian analysis, successfully distinguishing P. nigromaculatus and P. plancyi clades with moderate nodal support .

  • Model selection: When using Bayesian approaches, employing model selection tools like hierarchical likelihood ratio tests to identify the best-fit nucleotide substitution model (e.g., SYM+I+G for TYR gene data) improves phylogenetic inference .

  • Fixed difference identification: Analyzing TYR sequences for fixed differences between species provides diagnostic markers for species identification. Studies have identified fixed differences at several sites of the TYR gene between Pelophylax species clades .

  • Concatenation with other nuclear markers: Combining TYR data with other nuclear genes, such as POMC, strengthens phylogenetic signal and provides more robust species delimitation. This approach successfully separated P. nigromaculatus, P. plancyi, and P. fukienensis in previous studies .

  • Recombination testing: Prior to phylogenetic analysis, testing for recombination within the TYR gene (using methods like RDP4 or GARD) is essential, as recombination can confound phylogenetic inference. Studies of Pelophylax TYR sequences did not detect recombination events at global or pairwise levels .

  • Direct sequence examination: Beyond tree-building, direct examination of sequence data can reveal informative patterns. For instance, heterozygosity at all polymorphic sites between species identified a potential F₁ hybrid between P. plancyi and P. nigromaculatus .

What are the key considerations when designing primers for amplifying the TYR gene from P. nigromaculatus?

When designing primers for amplifying the TYR gene from P. nigromaculatus, researchers should consider several key factors to ensure successful amplification:

  • Conserved regions identification: Target primer binding sites in regions conserved across Pelophylax species but with sufficient variability in the amplified fragment to distinguish between species. Previous studies successfully used specific primers for TYR gene amplification in phylogenetic studies of Pelophylax species .

  • Exon-intron boundary awareness: Knowledge of exon-intron boundaries is crucial when studying splicing variants observed in P. nigromaculatus (lacking exons 2-4 or exon 4) . Primers should be designed to span these boundaries to detect potential splicing abnormalities.

  • Coverage of mutation hotspots: Ensure primers allow amplification of regions where known mutations occur, such as exons 1 and 4 where frameshift mutations and the deletion of three nucleotides encoding lysine have been identified .

  • Specificity testing: In silico analysis against related species sequences helps prevent non-specific amplification, particularly important when studying closely related species like P. nigromaculatus and P. plancyi where hybridization occurs .

  • GC content optimization: Balanced GC content (40-60%) improves primer stability and specificity. Avoiding regions with extreme GC content or secondary structures enhances amplification reliability.

  • Primer pair compatibility: Check primer pairs for complementarity to prevent primer-dimer formation, which can reduce amplification efficiency of the target region.

  • Optimization for specific applications: Different applications may require different primer design strategies:

    • For mutation detection: Design primers to amplify shorter fragments containing specific mutation sites

    • For phylogenetic studies: Target regions with appropriate evolutionary rates

    • For full-length cDNA cloning: Design primers at the 5' and 3' UTRs

  • Degenerate primers consideration: When working with samples from diverse populations, degenerate primers may accommodate potential polymorphisms at primer binding sites.

These considerations have proven effective in previous studies that successfully amplified the TYR gene for both mutation analysis in albino frogs and phylogenetic studies across Pelophylax species .

How can researchers resolve contradictory signals between mitochondrial and nuclear TYR gene phylogenies?

Resolving contradictory signals between mitochondrial and nuclear TYR gene phylogenies requires a systematic analytical approach:

  • Multi-locus nuclear analysis: Compare TYR gene trees with other nuclear gene trees (such as POMC) to establish a consensus nuclear signal. In studies of Pelophylax species, both TYR and POMC genes consistently separated P. nigromaculatus and P. plancyi into distinct clades, strengthening confidence in the nuclear signal despite contradictory mitochondrial patterns .

  • Explicit testing of introgression hypotheses: Formulate and test specific hypotheses about potential introgression events. The multiple mitochondrial genome introgression hypothesis (involving one ancient "forward" introgression from P. plancyi to P. nigromaculatus followed by recent "backward" introgressions) most parsimoniously explained the discordant patterns observed between nuclear and mitochondrial genes in Pelophylax species .

  • Coalescent-based analysis: Implement coalescent-based methods that can accommodate gene tree discordance due to incomplete lineage sorting versus introgression. These approaches model the probability of different evolutionary scenarios given the observed phylogenetic patterns.

  • Temporal pattern examination: Estimate and compare the timing of divergence events in both mitochondrial and nuclear lineages. In Pelophylax, researchers estimated that the ancient mitochondrial introgression occurred approximately 1.36 MYA, providing a temporal framework for understanding the evolutionary history .

  • Geographic correlation analysis: Map the geographic distribution of mitochondrial and nuclear haplotypes to identify spatial patterns consistent with introgression (e.g., geographic proximity between species) versus patterns expected under incomplete lineage sorting (which should be random with respect to geography).

  • Identification of hybrid individuals: Search for evidence of ongoing hybridization, such as individuals with mixed nuclear genomes. The identification of an F₁ hybrid (CNU5268) that was heterozygous at all polymorphic sites between P. plancyi and P. nigromaculatus provided direct evidence supporting the introgression hypothesis .

  • Consideration of biological characteristics: Evaluate whether biological features of the species make introgression more likely. In Pelophylax, asymmetrical reproductive ability of hybrids and continuous backcrossing were identified as likely mechanisms responsible for the observed mitochondrial introgression .

By employing these analytical approaches, researchers successfully resolved the contradictory signals between mitochondrial and TYR gene phylogenies in Pelophylax species, revealing a complex history of repeated introgression events rather than incomplete lineage sorting .

What experimental design is most appropriate for studying the catalytic activity of recombinant P. nigromaculatus TYR?

An optimal experimental design for studying the catalytic activity of recombinant P. nigromaculatus TYR should incorporate the following components:

  • Expression system optimization:

    • Compare multiple expression systems (bacterial, insect, and mammalian cells)

    • Evaluate the effect of expression temperature and copper supplementation

    • Consider fusion tags that enhance solubility while maintaining activity

  • Purification strategy:

    • Implement a multi-step purification protocol combining affinity chromatography with size exclusion

    • Maintain copper content throughout purification using copper-supplemented buffers

    • Test different buffer compositions to maximize stability and activity

  • Activity assay development:

    • Spectrophotometric monitoring of dopachrome formation (475 nm) using L-tyrosine and L-DOPA as substrates

    • Oxygen consumption measurement using Clark-type electrodes to directly quantify the oxidase activity

    • HPLC analysis of reaction products to confirm specific pathway intermediates

  • Structure-function analysis:

    • Site-directed mutagenesis targeting residues implicated in albinism (particularly those in copper-binding domains)

    • Circular dichroism to assess structural changes resulting from mutations

    • Thermal shift assays to evaluate protein stability changes associated with mutations

  • Comparative analysis:

    • Side-by-side comparison with tyrosinase from other species (human, mouse, other amphibians)

    • Evaluation of substrate specificity using a panel of phenolic compounds

    • Inhibitor sensitivity profiling to characterize active site properties

  • Environmental variable testing:

    • pH profile determination to identify optimal catalytic conditions

    • Temperature dependence studies to understand thermal stability

    • Metal ion effects (beyond copper) on enzymatic activity

  • Kinetic parameter determination:

    • Steady-state kinetics to determine KM and kcat for various substrates

    • Inhibition kinetics for competitive and non-competitive inhibitors

    • Pre-steady-state kinetics to identify rate-limiting steps in the catalytic cycle

This comprehensive experimental design would provide detailed insights into the catalytic properties of recombinant P. nigromaculatus TYR and how they relate to the enzyme's structural features, particularly those affected by mutations associated with albinism in wild frog populations .

How can TYR gene data contribute to conservation genetics of Pelophylax species?

The TYR gene offers valuable data for conservation genetics of Pelophylax species through several applications:

  • Species identification and hybridization detection: Nuclear TYR sequences provide reliable markers for distinguishing between closely related Pelophylax species and identifying hybrid individuals. The discovery of an F₁ hybrid (CNU5268) with heterozygosity at all polymorphic sites demonstrates the utility of TYR sequences for detecting hybridization events that might affect population integrity .

  • Population structure assessment: Analysis of TYR gene variation across populations can reveal fine-scale genetic structure. Fixed differences identified in the TYR gene between Pelophylax species provide diagnostic markers for assessing population differentiation and gene flow patterns .

  • Genetic diversity monitoring: TYR sequence polymorphism data can contribute to estimating genetic diversity within populations. Low diversity might indicate inbreeding or population bottlenecks requiring conservation intervention.

  • Introgression tracking: The ability of TYR sequences to detect introgression between species makes it valuable for monitoring genetic introgression that might threaten species integrity. The documented multiple mitochondrial introgression events between P. nigromaculatus and P. plancyi highlight the importance of monitoring nuclear genes in conservation genetics .

  • Adaptation significance assessment: Mutations in the TYR gene associated with albinism in wild frog populations provide insights into potentially adaptive or maladaptive genetic variations. The documented tyrosinase mutations in albino frogs from multiple populations offer a model for studying how such variations might affect survival in natural habitats .

  • Phylogeographic history reconstruction: TYR sequences can help reconstruct historical population movements and identify evolutionary significant units for conservation. The clear separation of Pelophylax species in TYR gene trees provides a framework for defining management units .

  • Non-invasive sampling applications: Primers targeting the TYR gene can be designed for use with environmental DNA (eDNA) or minimally invasive sampling methods, facilitating monitoring of rare or threatened populations without capture.

By incorporating TYR gene data into conservation genetic studies, researchers can develop more comprehensive management strategies for Pelophylax species that account for both historical evolutionary processes and contemporary threats such as hybridization and habitat fragmentation .

What bioinformatic pipelines are recommended for analyzing TYR sequence variation across amphibian species?

For comprehensive analysis of TYR sequence variation across amphibian species, the following bioinformatic pipeline components are recommended:

  • Sequence quality control and preprocessing:

    • Trimmomatic or Cutadapt for adapter removal and quality filtering

    • FLASH or PEAR for paired-end read merging if using NGS data

    • Chromatogram analysis tools (e.g., Geneious) for Sanger sequencing data quality assessment

  • Sequence alignment strategies:

    • MAFFT or MUSCLE for initial multiple sequence alignment

    • Gblocks or TrimAl for removing poorly aligned regions

    • Manual curation in Aliview or Jalview to verify alignment quality, particularly around indels

  • Phylogenetic analysis:

    • ModelTest-NG or jModelTest for selecting appropriate nucleotide substitution models (as performed for TYR gene analysis in Pelophylax species)

    • MrBayes or BEAST for Bayesian phylogenetic inference

    • RAxML or IQ-TREE for maximum likelihood tree construction

    • PAUP* for maximum parsimony analysis (which proved effective for TYR gene data in Pelophylax studies)

  • Recombination detection:

    • RDP4 or GARD to test for recombination events prior to phylogenetic analysis (as performed in Pelophylax studies)

    • SplitsTree for network analysis to visualize potential reticulate evolution

  • Population genetics analysis:

    • DnaSP for calculating nucleotide diversity, haplotype diversity, and tests of neutrality

    • MEGA for computing genetic distances and estimating divergence times

    • Arlequin for AMOVA and population structure analysis

  • Selection analysis:

    • PAML or HyPhy for detecting signatures of selection across codons

    • MEME for identifying sites under episodic selection

    • RELAX for testing for relaxed selection in specific lineages

  • Introgression and hybridization detection:

    • STRUCTURE or ADMIXTURE for identifying admixed individuals

    • D-statistics or ABBA-BABA tests for detecting introgression

    • PhyloNet for network-based analysis of reticulate evolution

  • Visualization tools:

    • FigTree or iTOL for phylogenetic tree visualization

    • R packages (ape, phytools, ggtree) for customized visualizations

    • PopART for haplotype network visualization

This comprehensive pipeline would enable researchers to thoroughly analyze TYR sequence variation, revealing evolutionary patterns similar to those discovered in Pelophylax species where both Bayesian and parsimony approaches successfully identified species-specific clades and detected evidence of hybridization and introgression .

How do naturally occurring TYR mutations in P. nigromaculatus compare to those found in human albinism?

Naturally occurring TYR mutations in P. nigromaculatus show both similarities and differences when compared to those found in human albinism:

  • Mutation types:

    • P. nigromaculatus: Frameshift mutations (thymine insertions in exons 1 and 4), deletion mutations (three nucleotides encoding lysine in exon 1), and splicing variants (lacking exons 2-4 or exon 4) have been documented .

    • Humans: Over 300 pathogenic variants have been identified, including missense mutations (most common), nonsense mutations, frameshift mutations, and splice site mutations.

  • Functional domains affected:

    • P. nigromaculatus: Mutations affect highly conserved amino acids, including a glycine in a related species (G. rugosa) located within a predicted copper-binding domain .

    • Humans: Many pathogenic mutations cluster in the copper-binding domains, particularly affecting copper-coordinating histidines or nearby residues that maintain the active site structure.

  • Conservation of critical residues:

    • Both species: The glycines and lysine affected in frog albinos are highly conserved across vertebrates, indicating their critical importance to tyrosinase function . This conservation underscores the similar functional constraints on tyrosinase across diverse vertebrate lineages.

  • Splicing effects:

    • P. nigromaculatus: Splicing variants lacking multiple exons (2-4) or a single exon (4) suggest unique mechanisms of splicing regulation .

    • Humans: While exon skipping does occur in human TYR mutations, the specific pattern of exons 2-4 skipping observed in P. nigromaculatus appears to be unique.

  • Unique mutations:

    • P. nigromaculatus: The five mutations identified in P. nigromaculatus albinos are all unique among vertebrates, suggesting that molecular analysis of albino frogs could contribute new information about tyrosinase structure and transcript processing .

    • Humans: Many human mutations are specific to certain populations or families, with some founder mutations being more common in particular ethnic groups.

  • Phenotypic spectrum:

    • P. nigromaculatus: The available research describes oculocutaneous albinism without detailing phenotypic variability .

    • Humans: Human TYR mutations produce a spectrum from complete OCA1A (no tyrosinase activity) to partial OCA1B (reduced activity), with varying degrees of pigmentation in skin, hair, and eyes.

The unique mutations found in P. nigromaculatus provide valuable comparative data that complement human studies, potentially offering insights into tyrosinase function that might not be apparent from human mutations alone . This cross-species perspective enhances our understanding of the molecular basis of albinism across vertebrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.