Recombinant Pelotomaculum thermopropionicum UPF0059 membrane protein PTH_2827 (PTH_2827)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Functional Annotation

Pelotomaculum thermopropionicum is a Gram-positive thermophile specializing in syntrophic propionate oxidation under anaerobic conditions . Its genome (3,025,375 bp) contains 2,920 coding sequences (CDSs), with PTH_2827 annotated as a hypothetical membrane protein belonging to the UPF0059 family .

Key Genomic Features of PTH_2827:

FeatureDetails
Gene LocusPTH_2827
UniProt IDA5CYC0
Protein NameUPF0059 membrane protein PTH_2827
Molecular Weight~20.5 kDa (calculated from AA sequence: 180 residues)
Functional CategoryCOG4656: Hypothetical membrane protein
Expression SystemRecombinant production in Escherichia coli with Tris-based buffer

The gene is located on the leading strand of the P. thermopropionicum genome, which is characteristic of Firmicutes bacteria . Despite its hypothetical classification, its genetic proximity to sulfur metabolism-related clusters suggests a potential role in sulfur anion transport or membrane stabilization .

Recombinant Expression and Purification

Recombinant PTH_2827 is produced in E. coli using a T7 promoter system, with yields optimized through tunable expression strains like Lemo21(DE3) . Key challenges include:

  • Hydrophobicity: Transmembrane domains (e.g., residues 1–180) necessitate detergent stabilization during purification .

  • Expression Optimization: Low expression levels are mitigated using glycerol storage (50%) and temperature-controlled cultivation .

Example Purification Protocol:

  1. Cultivation: E. coli Lemo21(DE3) cells grown at 37°C in LB medium with 0.1–1.0 mM rhamnose for T7 RNA polymerase induction .

  2. Membrane Isolation: Cells lysed via sonication; membranes solubilized with n-dodecyl-β-D-maltoside (DDM) .

  3. Affinity Chromatography: His-tag purification under denaturing conditions (8 M urea) .

Functional Hypotheses:

  • Electron Transport: Potential interaction with hydrogenases (e.g., PTH_0684–0686) .

  • Sulfur Metabolism: Genetic proximity to sulfate assimilation clusters (e.g., cysH, cysN) .

Applications:

  • Structural Biology: Crystallization trials for resolving membrane-protein interactions .

  • Syntrophic Metabolism Studies: Role in interspecies electron transfer with methanogens .

Challenges:

  • Low Solubility: Requires lipid nanodiscs or detergent micelles for stabilization .

  • Functional Validation: No enzymatic activity reported to date; in vitro assays needed .

Future Directions

  1. Cryo-EM Studies: Resolve 3D structure to identify catalytic or binding sites.

  2. Heterologous Co-Expression: Co-culture with methanogens to validate syntrophic interactions .

  3. Biotechnological Applications: Engineer PTH_2827 for bioenergy applications (e.g., microbial fuel cells) .

References

  1. Genome analysis of P. thermopropionicum (PMC2259108).

  2. Membrane protein expression challenges (PMID:16777403).

  3. Genomic annotation of PTH_2827 (biocomputo.ibt.unam.mx).

  4. Recombinant PTH_2827 product details (proteinfoldingcenter.org).

  5. Difficult-to-express proteins (futurefields.io).

  6. Lemo21(DE3) optimization (NEB).

  7. Physiological characterization of P. thermopropionicum (PMID:12361280).

  8. E. coli expression systems (creative-biolabs.com).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preference for a particular tag type, please specify it, and we will prioritize its implementation.
Synonyms
mntP; PTH_2827; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Target Names
mntP
Target Protein Sequence
MSFFTLMALAVALGTDALSLSVGIGLTGISRRRILQISATVLLFHIFMPLTGWLVGEFTG SLIGRAAAVIGSLLLVGLGVKMIWAAWRNGGETEPSLVRFNFWGLLLLGASVSMDALSAG FTLGTRQVNLLLAAGVIGLVAGAMTAGGLVFGRFLGSRVGERAQLLGGLILVGIGIKLFF
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.