Recombinant Penicillin-binding protein 2x (pbpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
pbpX; SP_0336; Penicillin-binding protein 2x; PBP-2x; PBP2x
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-750
Protein Length
full length protein
Species
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Target Names
pbpX
Target Protein Sequence
MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAIFLVNFAVIIGTGTRFGTDLAK EAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFN KVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDF TTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTDGIITYEKDR LGNIVPGTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQEKVKGKYMTATLVSAKTGE ILATTQRPTFDADTKEGITEDFVWRDILYQSNYEPGSTMKVMMLAAAIDNNTFPGGEVFN SSELKIADATIRDWDVNEGLTGGRTMTFSQGFAHSSNVGMTLLEQKMGDATWLDYLNRFK FGVPTRFGLTDEYAGQLPADNIVNIAQSSFGQGISVTQTQMIRAFTAIANDGVMLEPKFI SAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVLVGTDPVYGTMYNHSTGKPTVTVP GQNVALKSGTAQIADEKNGGYLVGLTDYIFSAVSMSPAENPDFILYVTVQQPEHYSGIQL GEFANPILERASAMKDSLNLQTTAKALEQVSQQSPYPMPSVKDISPGDLAEELRRNLVQP IVVGTGTKIKNSSAEEGKNLAPNQQVLILSDKAEEVPDMYGWTKETAETLAKWLNIELEF QGSGSTVQKQDVRANTAIKDIKKITLTLGD
Uniprot No.

Target Background

Function
Penicillin-binding proteins (PBPs) are involved in the final stages of murein biosynthesis. Beta-lactams inhibit PBPs by acylating a crucial serine residue within their active site.
Database Links

KEGG: spn:SP_0336

Protein Families
Transpeptidase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the functional role of PBP2x in bacterial cells?

PBP2x functions as an essential enzyme involved in the final stages of peptidoglycan assembly in Streptococcus pneumoniae. It plays a critical role in bacterial cell division and is vital for bacterial growth and survival. The protein localizes specifically to the division site during cell replication, a process that depends on its C-terminal PASTA (Penicillin-Binding Protein And Serine-Threonine-kinase Associated) domains. This localization pattern is crucial for proper septum formation and subsequent cell division. PBP2x's transpeptidase activity facilitates the cross-linking of peptidoglycan strands, contributing to cell wall integrity and bacterial morphology maintenance .

How do PASTA domains contribute to PBP2x function?

PASTA domains in PBP2x serve multiple critical functions that significantly impact the protein's activity and localization. These domains are responsible for proper localization of PBP2x to the division site during bacterial cell replication, as demonstrated through GFP-PBP2x fusion studies in living cells. The C-terminal PASTA domains, particularly PASTA2, play a crucial role in beta-lactam binding, with research showing that deletion of both PASTA domains (127 C-terminal residues) dramatically decreases binding by approximately 90%. Interestingly, even deletion of just 40 amino acids results in the same significant reduction in binding capacity, while deletion of only 30 amino acids affects binding marginally by about 10%. This graduated response indicates a structure-function relationship where specific regions within the PASTA domains are particularly important for antibiotic interactions .

What techniques are commonly used to visualize PBP2x localization in bacterial cells?

Fluorescent protein tagging, particularly using Green Fluorescent Protein (GFP), represents the primary methodology for visualizing PBP2x localization in living bacterial cells. Researchers typically create N-terminal GFP-PBP2x fusion proteins using vectors like pJWV25, which contain zinc-inducible promoters (PZn) and integrate into the chromosome of S. pneumoniae through double-crossover at specific loci (such as bgaA). This approach enables real-time observation of PBP2x localization patterns during various stages of bacterial growth and division. In properly functioning constructs, GFP-PBP2x localizes distinctly at septal sites, confirming its role in cell division processes. Mutations within critical domains, such as the PASTA domains, can disrupt this localization pattern, resulting in diffuse fluorescence throughout the cytoplasm rather than concentrated signal at division sites. This visualization technique has been instrumental in elucidating the importance of the C-terminal PASTA domains for proper PBP2x localization and function .

How do mutations in PASTA domains affect PBP2x localization and function?

Mutations in the PASTA domains of PBP2x can dramatically alter both protein localization and functional properties. Research has identified specific point mutations, such as A707D in the α-helix and G749V at the end of the β3-sheet of the PASTA2 domain, that prevent proper localization of GFP-tagged PBP2x to division sites. Instead of the normal septal localization pattern, these mutations result in diffuse cytoplasmic distribution of the protein. Additionally, these mutations can render the protein more susceptible to proteolytic degradation by the protease/chaperone HtrA, leading to reduced amounts of full-length GFP-PBP2x in the cell. The functional impact of PASTA domain mutations extends beyond localization to affect beta-lactam binding capacity. Experimental evidence demonstrates that the C-terminal α-helix of the PASTA2 domain is particularly critical for antibiotic binding, as its deletion resulted in almost complete loss of beta-lactam binding capability .

What structural differences exist between wild-type PBP2x and resistant variants?

Wild-type PBP2x and resistant variants exhibit several key structural differences that influence their interaction with beta-lactam antibiotics. The table below summarizes these differences:

FeatureWild-type PBP2xResistant Variants
Active Site ConfigurationOptimal for beta-lactam bindingModified to reduce antibiotic affinity
TP Domain Surface MutationsAbsentMay include mutations like G422D, R426C affecting domain interactions
PASTA Domain IntegrityComplete, functionalMay contain mutations (e.g., A707D, G749V) affecting localization
Protein StabilityHighOften reduced, increasing susceptibility to proteases like HtrA
Domain InteractionsStrong TP-PASTA interactionsWeakened interactions between domains
Beta-lactam Binding CapacityHigh affinitySignificantly reduced affinity
Localization PatternConcentrated at division sitesOften dispersed in resistant variants with PASTA mutations

These structural differences collectively contribute to the reduced effectiveness of beta-lactam antibiotics against resistant variants, primarily through mechanisms that prevent the formation of stable antibiotic-protein complexes at the active site .

How can recombinant PBP2x be efficiently expressed and purified for structural studies?

The efficient expression and purification of recombinant PBP2x for structural studies typically follows a multi-step protocol designed to maximize protein yield while maintaining functional integrity. First, the pbp2x gene from Streptococcus pneumoniae is cloned into an appropriate expression vector, often containing an N-terminal His-tag for purification purposes. This construct is then transformed into an E. coli expression strain, commonly BL21(DE3) or derivatives, which provides high-level protein expression under inducible conditions. Protein expression is optimized by adjusting parameters including induction temperature (typically 18-25°C for membrane-associated proteins), IPTG concentration (0.1-1.0 mM), and induction duration (4-16 hours). For purification, bacterial cells are harvested and lysed using either sonication or mechanical disruption in a buffer containing protease inhibitors to prevent degradation. The soluble fraction containing His-tagged PBP2x is then purified using nickel affinity chromatography, followed by size exclusion chromatography to ensure homogeneity. For structural studies requiring highly pure protein, additional purification steps such as ion exchange chromatography may be employed. Throughout the purification process, the functional integrity of PBP2x can be monitored using activity assays with fluorescent penicillin analogs like Bocillin FL. This methodological approach yields protein suitable for crystallographic studies, binding assays, and other structural analyses .

What are the recommended methods for assessing beta-lactam binding to PBP2x variants?

Assessment of beta-lactam binding to PBP2x variants requires precise methodologies that can quantitatively measure the interaction between the protein and antibiotics. The gold standard approach involves using fluorescent penicillin analogs, particularly Bocillin FL, which forms a covalent complex with the active site serine of functional PBP2x. In this assay, purified PBP2x variants are incubated with Bocillin FL, followed by SDS-PAGE separation and fluorescence detection to quantify binding capacity. Competition assays can further characterize binding affinity by pre-incubating PBP2x with various concentrations of non-fluorescent beta-lactams before adding Bocillin FL, allowing determination of IC50 values for different antibiotics. Surface plasmon resonance (SPR) provides an alternative method for measuring binding kinetics in real-time, offering detailed information about association and dissociation rates. For structural insights into binding mechanisms, X-ray crystallography of PBP2x variants in complex with beta-lactams can reveal atomic-level details of interaction sites. Additionally, thermal shift assays (differential scanning fluorimetry) can indicate changes in protein stability upon antibiotic binding. When comparing wild-type and mutant proteins, it's essential to ensure equivalent protein quantities through careful concentration determination, typically using Bradford or BCA assays combined with SDS-PAGE verification .

How can GFP-PBP2x fusion constructs be optimized for localization studies in live cells?

Optimizing GFP-PBP2x fusion constructs for localization studies in live cells requires careful consideration of multiple factors to ensure reliable and physiologically relevant results. The fusion design should maintain both GFP fluorescence and PBP2x functionality while minimizing artifacts. N-terminal GFP fusions are generally preferred for PBP2x, as they preserve the critical C-terminal PASTA domains essential for proper localization. The linker sequence between GFP and PBP2x plays a crucial role in fusion protein functionality; a flexible glycine-serine linker (GGGGS)n is often optimal, with the linker length requiring empirical determination (typically 5-15 amino acids). Expression level control is essential, as overexpression can lead to mislocalization artifacts; using inducible promoters like the zinc-inducible PZn allows titration of expression levels. The fusion construct should integrate into the chromosome at neutral loci (such as bgaA in S. pneumoniae) via double-crossover recombination to ensure stable expression. For live-cell imaging, cells should be grown in media that minimizes autofluorescence, and immobilized on microscope slides coated with 1% agarose in appropriate growth medium. Time-lapse imaging with 3-5 minute intervals provides valuable insights into dynamics of localization during cell division. Control experiments should include parallel imaging of wild-type cells to assess potential growth defects or morphological changes induced by the fusion protein .

How do different point mutations in PASTA domains differentially affect PBP2x functionality?

Point mutations in PASTA domains exhibit differential effects on PBP2x functionality depending on their specific location and the nature of the amino acid substitution. Mutations within the α-helix of the PASTA2 domain, such as A707D, typically produce more severe phenotypes than those in β-sheet regions, reflecting the critical role of this helical structure in maintaining proper protein conformation and function. Research demonstrates that point mutations in PASTA domains can affect multiple aspects of PBP2x functionality: protein stability, with some mutations rendering PBP2x more susceptible to degradation by proteases like HtrA; cellular localization, where mutations can disrupt the normal septal positioning essential for cell division; and beta-lactam binding capacity, with certain mutations significantly reducing antibiotic affinity without directly affecting the active site. The differential effects can be explained through structural modeling, which shows that some mutations disrupt intramolecular interactions between PASTA domains and the transpeptidase domain, while others affect intermolecular interactions with peptidoglycan or protein partners. These structure-function relationships highlight the importance of specific amino acid residues within PASTA domains in maintaining the proper three-dimensional architecture necessary for PBP2x to perform its essential cellular functions in peptidoglycan synthesis and bacterial cell division .

What is the relationship between PBP2x PASTA domains and the development of beta-lactam resistance in clinical isolates?

The relationship between PBP2x PASTA domains and beta-lactam resistance development in clinical isolates represents a complex evolutionary adaptation in pathogenic bacteria. While classical resistance mutations occur primarily within the transpeptidase domain, research has revealed that PASTA domain alterations significantly contribute to resistance phenotypes through several mechanisms. Clinical isolates with reduced beta-lactam susceptibility frequently harbor mutations in PASTA domains that subtly alter the protein's conformation, indirectly affecting the active site architecture and reducing antibiotic binding affinity without compromising enzymatic function. These mutations appear to be selected during antibiotic exposure, suggesting they provide a fitness advantage under selective pressure. Structural analyses indicate that PASTA domain mutations can affect van der Waals interactions with both the transpeptidase domain and noncovalent beta-lactam molecules, providing a molecular explanation for their contribution to resistance. Importantly, PASTA domain mutations often work synergistically with transpeptidase domain mutations, with the combination producing higher resistance levels than either alone. This synergy suggests a stepwise evolutionary pathway wherein initial low-level resistance mutations in PASTA domains may facilitate the subsequent acquisition of more dramatic resistance mutations in the active site region. The clinical significance of these findings extends to diagnostic approaches for detecting resistance, which should consider PASTA domain sequences alongside the traditionally examined transpeptidase domain .

How do interactions between PBP2x and other cell division proteins influence antibiotic susceptibility?

Interactions between PBP2x and other cell division proteins create a complex network that significantly influences antibiotic susceptibility through multiple mechanisms. PBP2x functions within a multiprotein divisome complex, where it interacts with other penicillin-binding proteins (particularly PBP1a and PBP2b), cell wall hydrolases, cytoskeletal proteins like FtsZ, and regulatory kinases including StkP. These protein-protein interactions are essential for coordinated cell wall synthesis during division and can directly affect beta-lactam susceptibility. When beta-lactams bind to PBP2x, they not only inhibit its transpeptidase activity but also potentially disrupt its interactions with partner proteins, leading to divisome destabilization. Research indicates that mutations affecting these protein-protein interactions can contribute to resistance by maintaining divisome integrity even in the presence of antibiotics. Additionally, the interplay between PBP2x and regulatory proteins influences its phosphorylation state, which in turn affects protein activity and antibiotic binding. For example, the serine/threonine kinase StkP phosphorylates residues in PBP2x, potentially modulating its conformation and function. In some resistant strains, altered phosphorylation patterns have been associated with reduced antibiotic susceptibility. Furthermore, interactions with molecular chaperones and proteases like HtrA regulate PBP2x stability and turnover, with implications for resistance development. A comprehensive understanding of this interaction network provides potential targets for novel therapeutic approaches aimed at overcoming resistance .

What novel therapeutic strategies might emerge from understanding PBP2x structure-function relationships?

Understanding the intricate structure-function relationships of PBP2x opens several promising avenues for novel therapeutic strategies to combat resistant bacterial infections. One emerging approach involves developing beta-lactam derivatives specifically designed to interact with both the transpeptidase domain and PASTA domains simultaneously, potentially overcoming resistance mutations in either region alone. Structural analyses have revealed that the PASTA domains create a potential binding pocket for beta-lactams that could be exploited for designing new antibiotics with enhanced affinity. Another promising strategy focuses on targeting the PASTA domain-mediated localization mechanism rather than enzymatic activity, as compounds that prevent proper PBP2x localization would disrupt cell division without directly competing with resistance mechanisms at the active site. Combination therapies targeting multiple PBPs with different binding site preferences could reduce the likelihood of resistance development, particularly when designed based on structural similarities and differences between PBP family members. Additionally, allosteric inhibitors that bind to sites distant from the active site but induce conformational changes affecting beta-lactam binding represent an untapped therapeutic approach. Peptide mimetics that interfere with protein-protein interactions between PBP2x and other divisome components could also disrupt the cell division machinery in ways that circumvent traditional resistance mechanisms. These diverse strategies, all grounded in detailed structural knowledge of PBP2x, offer multiple paths forward in the ongoing battle against antibiotic-resistant bacterial pathogens .

How can high-throughput screening methods be optimized to identify compounds targeting resistant PBP2x variants?

Optimizing high-throughput screening (HTS) methods for identifying compounds effective against resistant PBP2x variants requires sophisticated approaches tailored to the unique structural and functional characteristics of these proteins. A comprehensive HTS strategy should incorporate multiple complementary assays to identify diverse inhibition mechanisms. Activity-based screening can utilize fluorescent D-alanine derivatives to monitor transpeptidase activity in real-time, allowing detection of compounds that inhibit enzymatic function regardless of their binding site. Binding-based assays using fluorescence polarization with labeled beta-lactams can identify compounds that compete for active site binding, while thermal shift assays detect molecules that stabilize or destabilize PBP2x upon binding, potentially identifying allosteric inhibitors. Cell-based phenotypic screens using bacteria expressing fluorescently tagged PBP2x can identify compounds that disrupt protein localization at the division septum. To specifically target resistant variants, screening libraries should be tested against both wild-type and resistant PBP2x proteins in parallel, with particular attention to compounds showing greater efficacy against resistant forms. Fragment-based screening approaches can identify chemical scaffolds with even weak activity that can be optimized through medicinal chemistry. Additionally, virtual screening using molecular docking against crystal structures of resistant PBP2x variants can prioritize compounds for experimental testing. The table below summarizes key components of an optimized HTS strategy:

Screening ApproachMethodologyTarget MechanismAdvantages
Activity-basedFluorescent D-Ala substrate assayTranspeptidase inhibitionIdentifies functional inhibitors regardless of binding site
Binding competitionFluorescence polarizationActive site competitionDirectly measures binding affinity
Thermal stabilityDifferential scanning fluorimetryAllosteric modulationIdentifies non-competitive inhibitors
LocalizationGFP-PBP2x cellular imagingDisruption of septal localizationPhysiologically relevant screening
Fragment-basedNMR or X-ray crystallographyMultiple binding sitesIdentifies novel chemical scaffolds
Structure-based virtualMolecular dockingPredicted binding sitesCost-effective initial filtering

This multi-faceted approach maximizes the probability of identifying novel inhibitors effective against resistant PBP2x variants .

What role might PBP2x play in developing combination therapies for resistant Streptococcus pneumoniae infections?

PBP2x plays a pivotal role in the development of combination therapies for resistant Streptococcus pneumoniae infections, offering several strategic advantages in addressing the complex challenge of antimicrobial resistance. Combination therapies targeting PBP2x alongside other cellular components can exploit synergistic interactions to overcome resistance mechanisms. One promising approach pairs beta-lactams with beta-lactamase inhibitors that protect the antibiotic from enzymatic degradation while simultaneously targeting PBP2x through novel binding mechanisms. Research indicates that certain beta-lactam combinations can overcome resistance by saturating multiple PBPs (including PBP2x, PBP1a, and PBP2b) simultaneously, preventing compensatory activity when one PBP is inhibited. Furthermore, combinations of beta-lactams with non-beta-lactam antibiotics targeting cell wall synthesis (like vancomycin or fosfomycin) can attack multiple steps in the peptidoglycan assembly pathway, reducing the likelihood of resistance development. The known structure-function relationships of PBP2x enable rational design of such combinations by identifying compounds that bind to different domains of the protein or exploit different interaction mechanisms. Additionally, targeting the regulatory pathways controlling PBP2x expression or localization in combination with direct inhibitors presents another strategy, as compounds disrupting PBP2x localization to the division septum could enhance the efficacy of traditional beta-lactams. Clinical studies suggest that implementing PBP2x-targeted combination therapies could significantly reduce treatment failure rates in infections caused by resistant S. pneumoniae strains, potentially revitalizing the use of existing beta-lactam antibiotics through strategic combinations that overcome established resistance mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.