Recombinant Penicillium chrysogenum Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rcf1; aim31; Pc13g07740; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum)
Target Names
rcf1
Target Protein Sequence
MSREPVPSSFDEGNPQFTEETGMQKFTRRLKEEPLVPLGCAATCYALYRAYRSMKSGDSV EMNRMFRARIYAQAFTLVALVAGGMYFKTERQQRREFDQAVELRKKQEKRDAWLRELEIR DKEDREWRERHAAIEAAAKEAGNKAAPRKEPEAARSSIEPADEKSIGVMDAVRALISRN
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Penicillium chrysogenum and how has its classification evolved?

Penicillium chrysogenum is a species of fungus in the genus Penicillium (kingdom Fungi) that occurs across various habitats, especially in moist areas including forests and damp indoor environments. The taxonomic classification has evolved considerably, as P. chrysogenum has been recognized as part of a species complex that includes P. notatum, P. meleagrinum, and P. cyaneofulvum . Notably, molecular phylogeny has established that Alexander Fleming's original penicillin-producing strain is actually a distinct species, P. rubens, rather than P. notatum as initially classified . During various periods, P. chrysogenum has been considered synonymous with both P. rubens and P. notatum, creating some taxonomic confusion in historical literature . This reclassification highlights the importance of modern molecular techniques in fungal taxonomy beyond traditional morphological characteristics.

What are the key characteristics for identifying Penicillium chrysogenum in laboratory settings?

  • Morphological observations including microscopic features

  • DNA sequencing to distinguish it from closely related species such as P. rubens

  • Analysis of secondary metabolite profiles (chemotaxonomy)

  • PCR amplification to determine mating types (MAT1-1 or MAT1-2) when studying sexual reproduction potential

The sexual stage of P. chrysogenum was only discovered in 2013 by mating cultures in the dark on oatmeal agar supplemented with biotin . This discovery emphasized the importance of specific cultivation conditions for observing complete life cycles in laboratory settings.

What is Aim31/Rcf1 and what is its role in mitochondrial function?

Aim31, now renamed as Rcf1 (Respiratory supercomplex factor 1), is a mitochondrial protein originally discovered in a screen designed to identify genes encoding proteins whose absence caused an altered inheritance of mitochondrial DNA (AIM) . Rcf1 is a member of the conserved hypoxia-induced gene 1 (Hig1) protein family and has been identified as a novel component associated with the cytochrome bc1-COX supercomplex in the mitochondrial respiratory chain .

Research has demonstrated that Rcf1:

  • Binds to both the cytochrome bc1 and COX enzyme domains of the supercomplex

  • Shows a closer physical relationship with the Cox3 protein component of the COX complex

  • Functions cooperatively with another mitochondrial protein, Aim38 (renamed Rcf2)

  • Plays a critical role in the assembly and stability of the cytochrome bc1-COX supercomplex

  • Influences COX enzyme activity and the assembly of peripheral COX subunits Cox12 and Cox13

When both Rcf1 and Rcf2 are absent (but not when only one is missing), there is a significant impact on COX enzyme activity and assembly, suggesting these proteins may act as bridges to support the assembly of the supercomplex state .

How do researchers differentiate between Aim31/Rcf1 and other mitochondrial proteins in experimental settings?

Differentiating Aim31/Rcf1 from other mitochondrial proteins requires a combination of biochemical and molecular approaches:

  • Blue Native PAGE (BN-PAGE): This technique allows visualization of the cytochrome bc1-COX supercomplex on native gels. Rcf1 appears as an 18-kDa protein comigrating with the supercomplex .

  • Affinity purification: Using histidine (His)-tagged cytochrome c1 and Aac2 derivatives under mild digitonin solubilization conditions to maintain the organization of the supercomplex. This approach confirmed that Rcf1 specifically copurifies with both cytochrome components .

  • Mass spectrometry analysis: This technique provided definitive identification of the protein encoded by the AIM31/YML030w gene .

  • Comparative protein sequence analysis: Sequence comparison to identify homology with members of the Hig1 protein family helps distinguish Rcf1 from other mitochondrial proteins.

These methods collectively enable researchers to specifically identify and study Aim31/Rcf1 in the context of the complex mitochondrial proteome.

What are the optimal conditions for expressing recombinant Aim31/Rcf1 in laboratory settings?

Based on previous research with recombinant proteins from P. chrysogenum, the following conditions have proven effective for expressing recombinant Aim31/Rcf1:

Expression System Options:

  • E. coli for basic structural studies (Note: protein may form inclusion bodies)

  • Yeast expression systems (particularly S. cerevisiae) for functional studies given the protein's mitochondrial nature

  • P. chrysogenum's own expression system for native protein studies

Key Expression Parameters:

  • Vector selection: Vectors containing strong inducible promoters with mitochondrial targeting sequences

  • Recovery method: As observed with other recombinant P. chrysogenum proteins, recovery from inclusion bodies under denaturing conditions may be necessary

  • Protein validation: Confirmation using monoclonal antibodies specific to the target protein and N-terminal amino acid sequencing

  • Functional validation: Assessment of interaction with cytochrome bc1-COX supercomplex components

When expressing mitochondrial proteins like Aim31/Rcf1, it's critical to incorporate appropriate mitochondrial targeting sequences to ensure proper localization and folding of the recombinant protein.

What methods are most effective for studying Aim31/Rcf1 interaction with the mitochondrial respiratory chain complexes?

Several complementary approaches have proven effective for studying Aim31/Rcf1 interactions with respiratory chain complexes:

  • Affinity Purification with Mild Detergents:

    • Using digitonin for solubilization to maintain supercomplex integrity

    • His-tagged cytochrome components as bait proteins

    • Analysis of co-purifying proteins by mass spectrometry

  • Blue Native PAGE (BN-PAGE):

    • Separation of intact respiratory complexes and supercomplexes

    • Western blotting with specific antibodies to identify associated proteins

    • Comparison of migration patterns between wild-type and knockout strains

  • Functional Assays:

    • Measurement of COX enzyme activity using casein as substrate at pH 8.0

    • Inhibition studies with specific inhibitors like phenylmethylsulfonyl fluoride or diethylpyrocarbonate

    • Assessment of substrate specificity (e.g., ability to degrade gelatin and collagen but not elastin)

  • Genetic Approaches:

    • Generation of single and double knockout mutants (Δrcf1, Δrcf2, Δrcf1Δrcf2)

    • Complementation studies with recombinant constructs

    • Site-directed mutagenesis of key residues to identify functional domains

These methodologies enable researchers to comprehensively characterize the physical associations and functional relationships between Aim31/Rcf1 and respiratory chain components.

How does the function of Aim31/Rcf1 in P. chrysogenum compare to its homologs in other fungal species?

Comparative analysis of Aim31/Rcf1 across fungal species reveals important evolutionary and functional insights:

OrganismProtein NameSequence Identity to P. chrysogenum Aim31/Rcf1Key Functional Differences
S. cerevisiaeRcf1 (Aim31)High similarity to Hig1 familyAssociates with bc1-COX supercomplex; affects mtDNA inheritance
P. citrinumAlkaline serine protease (Pen c 13)~83% identity with P. chrysogenum proteaseFunctions primarily as an allergen
A. fumigatusAlkaline serine protease~49% identity with P. chrysogenum proteaseDifferent substrate specificity
P. rubensRcf1 homologVery high similarity (near identity)Functionally equivalent

The function of Aim31/Rcf1 appears conserved across Penicillium species, but with some notable differences from more distant fungi. While the Saccharomyces cerevisiae Rcf1 protein is primarily involved in respiratory supercomplex assembly and stability, some Penicillium species have homologs that show additional enzymatic functions .

The alkaline serine protease in P. chrysogenum (potentially related to Aim31) shows 83% sequence identity with the alkaline serine protease from P. citrinum and 49% with that from A. fumigatus . These proteases maintain enzymatic activity that may be less prominent in the S. cerevisiae homolog.

This suggests that while the core function in mitochondrial respiration may be conserved, these proteins may have evolved additional species-specific functions related to adaptation to different ecological niches.

What are the challenges in generating stable recombinant P. chrysogenum strains with modified Aim31/Rcf1 expression?

Generating stable recombinant P. chrysogenum strains with modified Aim31/Rcf1 expression presents several significant challenges:

  • Mitochondrial Targeting Complications:

    • Ensuring proper localization of modified Aim31/Rcf1 to mitochondria

    • Maintaining correct processing of pre- and pro-enzyme sequences

    • Balancing expression levels to avoid disruption of mitochondrial function

  • Genetic Manipulation Barriers:

    • Lower transformation efficiency compared to model organisms

    • Limited availability of selection markers specific for P. chrysogenum

    • Potential impact on secondary metabolite production pathways

  • Functional Assessment Difficulties:

    • Distinguishing between direct effects of Aim31/Rcf1 modification and indirect metabolic consequences

    • Unpredictable impacts on respiratory chain assembly and function

    • Potential compensatory mechanisms through Rcf2 (Aim38) upregulation

  • Stability Concerns:

    • Maintaining genetic stability over multiple generations

    • Potential selection pressure against strains with compromised respiratory function

    • Influence of modified Aim31/Rcf1 on mitochondrial DNA inheritance and stability

Researchers should consider employing precise genome editing technologies with robust selection systems, while implementing careful phenotypic monitoring throughout the strain development process.

How can CRISPR-Cas9 or similar genome editing technologies be optimized for modifying Aim31/Rcf1 in P. chrysogenum?

Optimizing CRISPR-Cas9 for modifying Aim31/Rcf1 in P. chrysogenum requires specialized approaches:

  • Guide RNA Design Considerations:

    • Target unique sequences within the AIM31 gene to prevent off-target effects

    • Ensure adequate GC content for stability in the fungal cellular environment

    • Validate guide RNA effectiveness in silico before experimental implementation

  • Delivery Method Optimization:

    • Protoplast-based transformation with optimized regeneration conditions

    • Plasmid-based expression systems with fungal-specific promoters

    • Ribonucleoprotein (RNP) complex delivery to maximize editing efficiency and reduce off-target effects

  • Verification Strategies:

    • PCR-based genotyping followed by sequencing confirmation

    • Functional assays to assess mitochondrial respiratory complex assembly

    • Western blotting to confirm protein expression modification

    • BN-PAGE analysis to evaluate impacts on supercomplex formation

  • Alternative Editing Approaches:

    • Consider precision editors like ARCUS, which has demonstrated effectiveness in targeting mitochondrial DNA

    • ARCUS technology has shown success in preferentially targeting and eliminating mutant mitochondrial DNA with high specificity

    • The single-component nature of ARCUS nucleases may offer advantages for mitochondrial targeting compared to multi-component CRISPR systems

Employing these optimized strategies can significantly improve the efficiency and specificity of genome editing when targeting mitochondrial genes like AIM31 in P. chrysogenum.

What implications does research on Aim31/Rcf1 have for understanding mitochondrial disease mechanisms?

Research on Aim31/Rcf1 has significant implications for understanding mitochondrial disease mechanisms:

  • Respiratory Chain Assembly Insights:

    • Aim31/Rcf1's role in the assembly and stability of respiratory supercomplexes provides a model for understanding how disruption of these processes could contribute to mitochondrial diseases

    • The interaction between Rcf1 and Cox3 highlights potential points of vulnerability in respiratory chain assembly

  • Mitochondrial DNA Inheritance Mechanisms:

    • Understanding how Aim31/Rcf1 affects mitochondrial DNA inheritance could illuminate mechanisms underlying mtDNA-related disorders

    • Research on heteroplasmy (mixed populations of normal and mutant mtDNA) in relation to Aim31/Rcf1 function may inform therapeutic approaches

  • Potential Therapeutic Targets:

    • Modulating Aim31/Rcf1 or related proteins could potentially restore respiratory chain function in certain mitochondrial diseases

    • Research on mitoARCUS nucleases demonstrates how targeting specific mitochondrial DNA mutations can shift heteroplasmy toward wild-type mtDNA and improve mitochondrial function

  • Biomarker Development:

    • Altered Aim31/Rcf1 expression or function could serve as biomarkers for specific mitochondrial dysfunctions

    • Understanding the relationship between Aim31/Rcf1 and respiratory complex assembly could lead to new diagnostic approaches

These insights from basic research on Aim31/Rcf1 provide valuable frameworks for understanding the molecular basis of mitochondrial diseases and developing potential intervention strategies.

What are the most promising avenues for future research on Aim31/Rcf1 in P. chrysogenum?

Several promising research directions could advance our understanding of Aim31/Rcf1 in P. chrysogenum:

  • Comparative Genomics and Evolution:

    • Comprehensive comparison of Aim31/Rcf1 homologs across diverse fungal species

    • Investigation of selective pressures that have shaped Aim31/Rcf1 function in different ecological niches

    • Analysis of co-evolution with interacting proteins in the respiratory chain

  • Structural Biology Approaches:

    • Determination of high-resolution crystal or cryo-EM structures of Aim31/Rcf1 alone and in complex with respiratory chain components

    • Identification of critical domains for protein-protein interactions and mitochondrial targeting

    • Structure-guided mutagenesis to define functional regions

  • Systems Biology Integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics to understand the broader cellular impact of Aim31/Rcf1 modification

    • Network analysis to identify regulatory pathways controlling Aim31/Rcf1 expression and function

    • Mathematical modeling of respiratory chain assembly with and without Aim31/Rcf1

  • Biotechnological Applications:

    • Exploration of Aim31/Rcf1 modification as a strategy to enhance secondary metabolite production

    • Development of Aim31/Rcf1-based biosensors for mitochondrial function

    • Engineering of synthetic Aim31/Rcf1 variants with enhanced or novel functions

These research directions could significantly expand our understanding of mitochondrial biology and potentially lead to biotechnological applications.

How might research on P. chrysogenum Aim31/Rcf1 contribute to developing new therapeutic approaches for mitochondrial disorders?

Research on P. chrysogenum Aim31/Rcf1 could contribute to novel therapeutic approaches for mitochondrial disorders through several mechanisms:

The fundamental knowledge gained from studying Aim31/Rcf1 in model organisms like P. chrysogenum provides critical insights that can be translated to human mitochondrial biology and pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.